KEGG   Homo sapiens (human): 2099Help
Entry
2099              CDS       T01001                                 

Gene name
ESR1, ER, ESR, ESRA, ESTRR, Era, NR3A1
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  estrogen receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
Network
N00286  Nuclear-initiated estrogen signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
Disease
H00031  Breast cancer
H02061  Estrogen resistance syndrome
Drug target
Acolbifene hydrochloride: D02758
Afimoxifene: D06551
Alfatradiol: D07121
Arzoxifene hydrochloride: D02993
Bazedoxifene: D03062
Chlorotrianisene: D00269
Clometherone: D03551
Clomifene (DG00474): D00962 D07726
Danazol: D00289
Delmadinone (DG02935): D03675 D07783
Desogestrel: D02367
Dienestrol: D00898
Diethylstilbestrol (DG00466): D00577 D00946 D07826
Droloxifene (DG01265): D03911 D03912
Enclomiphene (DG01992): D08910 D10876
Epitiostanol: D01265
Equilin: D04041
Estradiol (DG00462): D00105 D01413 D01617 D01953 D04061 D04063 D04064 D04065 D07918 D07919
Estriol (DG00463): D00185 D01986 D01989 D07920 D07921
Estrogens, esterified: D04071
Estrone (DG00464): D00067 D00312 D00948
Ethinylestradiol (DG00461): D00554 D07928
Etonogestrel: D04104
Etynodiol (DG00470): D01294 D07939
Fispemifene: D10008
Fulvestrant: D01161
Hexestrol (DG02847): D01641 D02018
Idoxifene: D04496
Lasofoxifene: D04672
Levormeloxifene fumarate: D09834
Mepitiostane: D01602
Mestranol: D00575
Miproxifene phosphate: D01853
Nafoxidine hydrochloride: D05106
Nitromifene citrate: D05192
Ormeloxifen: D08301
Ospemifene: D08958
Polyestradiol phosphate: D07434
Prasterone (DG00141): D01616 D08409
Promestriene: D07221
Quinestrol: D00576
Raloxifene (DG00476): D02217 D08465 D10606
Tamoxifen (DG00734): D00966 D08559
Tibolone: D01639
Toremifene (DG00735): D00967 D08620
Trioxifene mesylate: D06245
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2099 (ESR1)
   04917 Prolactin signaling pathway
    2099 (ESR1)
   04919 Thyroid hormone signaling pathway
    2099 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    2099 (ESR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2099 (ESR1)
   05205 Proteoglycans in cancer
    2099 (ESR1)
  09162 Cancers: Specific types
   05224 Breast cancer
    2099 (ESR1)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    2099 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2099 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    2099 (ESR1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2099 (ESR1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2099 (ESR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Motif
Other DBs
NCBI-GeneID: 2099
NCBI-ProteinID: NP_000116
OMIM: 133430
HGNC: 3467
Ensembl: ENSG00000091831
Vega: OTTHUMG00000016103
Pharos: P03372(Tclin)
UniProt: P03372 G4XH65
Structure
PDB: 
5DXE 5UFX 5UFW 5KCT 3UUD 2IOG 1XPC 6CBZ 5W9D 6CHZ 2QXS 1XP6 2QZO 5FQV 4ZNV 5KD9 2B1Z 5WGD 5W9C 4MGA 2B1V 1XP9 1XP1 5KCD 2YJA 2POG 5KCE 4TV1 4MG8 4MGB 2QSE 2QA8 5U2D 5TN4 5DXG 4ZNS 5FQP 5FQR 5ACC 6CHW 5TN5 2QAB 5TLT 5DZI 5AAU 4ZNT 4TUZ 4PXM 4MGD 3L03 2AYR 1YIM 1SJ0 3ERT 5KCW 5DWE 4ZN7 4ZNH 4PPS 4IWF 5FQS 2P15 5AAV 4IVY 2Q70 1L2I 5E1C 4IW6 5TM8 5FQT 6C42 5E0W 5DWJ 4MG9 2R6W 2R6Y 2QR9 2OUZ 2BJ4 1X7R 5E0X 5KCU 5DY8 3OS8 3ERD 4IW8 5TMT 4MG5 3UUA 3Q95 1XQC 5TN1 4IVW 5KCF 5DRJ 5TNB 5TLP 5DXB 5TN6 5DX3 5DUE 5TLX 5T1Z 5KRO 5JMM 5E15 5DL4 4MG6 3UUC 2JF9 2FAI 2B23 5DZH 5TLY 4IV2 5DZ3 5DKG 4MG7 4MGC 2QGT 5TMO 5TM3 5KRF 5AK2 5TMM 5TLF 5DZ1 5DXP 5DU5 4PP6 3UU7 1YIN 5TMZ 5U2B 5TLU 5T92 5E14 4ZN9 5TM1 5TLG 5DXK 5TMQ 5TMS 5TN7 5TM5 5KRH 5KRM 5E19 5DZ0 5DUH 5DRM 5DIG 5DI7 5DID 5DIE 4Q13 4IWC 5TML 5TN9 5TM4 5KR9 5KRI 5DUG 1ZKY 5DLR 5HYR 5DYB 5TLO 5DXR 5DVS 5DK9 1UOM 5TMW 4IU7 5WGQ 5TMR 5DWG 5DTV 4IV4 4IUI 4DMA 3OS9 3OSA 2QXM 2G5O 4ZNW 5TLV 3HM1 5DXM 5TMV 5TLD 5DP0 5KRK 5KCC 2QGW 5TM7 5GS4 5KRA 5KRC 5KRL 5EI1 5DXQ 5DMC 5DMF 5DKB 4ZNU 3DT3 2QE4 2IOK 1GWR 1HCQ 5TLL 5TMU 5DWI 1GWQ 5DYD 4XI3 5TM9 5TLM 5EHJ 5DVV 5TN3 5TM6 2JFA 5TM2 5DKE 5DKS 4AA6 2YAT 2QA6 1ERR 5TN8 2G44 5EIT 4PPP 5KRJ 2QH6 2Q6J 1R5K 1PCG 5GTR 1X7E 1A52 6B0F 5EGV 2I0J 1G50 2OCF 5T97 3HLV 4Q50 1ERE 1QKU 1QKT 1HCP
Thumbnails

Position
6q25.1-q25.2
AA seq 595 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccctccacaccaaagcatctgggatggccctactgcatcagatccaaggg
aacgagctggagcccctgaaccgtccgcagctcaagatccccctggagcggcccctgggc
gaggtgtacctggacagcagcaagcccgccgtgtacaactaccccgagggcgccgcctac
gagttcaacgccgcggccgccgccaacgcgcaggtctacggtcagaccggcctcccctac
ggccccgggtctgaggctgcggcgttcggctccaacggcctggggggtttccccccactc
aacagcgtgtctccgagcccgctgatgctactgcacccgccgccgcagctgtcgcctttc
ctgcagccccacggccagcaggtgccctactacctggagaacgagcccagcggctacacg
gtgcgcgaggccggcccgccggcattctacaggccaaattcagataatcgacgccagggt
ggcagagaaagattggccagtaccaatgacaagggaagtatggctatggaatctgccaag
gagactcgctactgtgcagtgtgcaatgactatgcttcaggctaccattatggagtctgg
tcctgtgagggctgcaaggccttcttcaagagaagtattcaaggacataacgactatatg
tgtccagccaccaaccagtgcaccattgataaaaacaggaggaagagctgccaggcctgc
cggctccgcaaatgctacgaagtgggaatgatgaaaggtgggatacgaaaagaccgaaga
ggagggagaatgttgaaacacaagcgccagagagatgatggggagggcaggggtgaagtg
gggtctgctggagacatgagagctgccaacctttggccaagcccgctcatgatcaaacgc
tctaagaagaacagcctggccttgtccctgacggccgaccagatggtcagtgccttgttg
gatgctgagccccccatactctattccgagtatgatcctaccagacccttcagtgaagct
tcgatgatgggcttactgaccaacctggcagacagggagctggttcacatgatcaactgg
gcgaagagggtgccaggctttgtggatttgaccctccatgatcaggtccaccttctagaa
tgtgcctggctagagatcctgatgattggtctcgtctggcgctccatggagcacccaggg
aagctactgtttgctcctaacttgctcttggacaggaaccagggaaaatgtgtagagggc
atggtggagatcttcgacatgctgctggctacatcatctcggttccgcatgatgaatctg
cagggagaggagtttgtgtgcctcaaatctattattttgcttaattctggagtgtacaca
tttctgtccagcaccctgaagtctctggaagagaaggaccatatccaccgagtcctggac
aagatcacagacactttgatccacctgatggccaaggcaggcctgaccctgcagcagcag
caccagcggctggcccagctcctcctcatcctctcccacatcaggcacatgagtaacaaa
ggcatggagcatctgtacagcatgaagtgcaagaacgtggtgcccctctatgacctgctg
ctggagatgctggacgcccaccgcctacatgcgcccactagccgtggaggggcatccgtg
gaggagacggaccaaagccacttggccactgcgggctctacttcatcgcattccttgcaa
aagtattacatcacgggggaggcagagggtttccctgccacggtctga

DBGET integrated database retrieval system