KEGG   Homo sapiens (human): 218Help
Entry
218               CDS       T01001                                 

Gene name
ALDH3A1, ALDH3, ALDHIII
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    218 (ALDH3A1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    218 (ALDH3A1)
   00350 Tyrosine metabolism
    218 (ALDH3A1)
   00360 Phenylalanine metabolism
    218 (ALDH3A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    218 (ALDH3A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    218 (ALDH3A1)
   00982 Drug metabolism - cytochrome P450
    218 (ALDH3A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    218 (ALDH3A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     218 (ALDH3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 218
NCBI-ProteinID: NP_000682
OMIM: 100660
HGNC: 405
Ensembl: ENSG00000108602
Vega: OTTHUMG00000059469
Pharos: P30838(Tchem)
UniProt: P30838 Q6PKA6
Structure
PDB: 

Position
17p11.2
AA seq 453 aa AA seqDB search
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcagcgaggccgtgaagcgcgcccgcgccgccttcagctcgggcaggacc
cgtccgctgcagttccggatccagcagctggaggcgctgcagcgcctgatccaggagcag
gagcaggagctggtgggcgcgctggccgcagacctgcacaagaatgaatggaacgcctac
tatgaggaggtggtgtacgtcctagaggagatcgagtacatgatccagaagctccctgag
tgggccgcggatgagcccgtggagaagacgccccagactcagcaggacgagctctacatc
cactcggagccactgggcgtggtcctcgtcattggcacctggaactaccccttcaacctc
accatccagcccatggtgggcgccatcgctgcagggaactcagtggtcctcaagccctcg
gagctgagtgagaacatggcgagcctgctggctaccatcatcccccagtacctggacaag
gatctgtacccagtaatcaatgggggtgtccctgagaccacggagctgctcaaggagagg
ttcgaccatatcctgtacacgggcagcacgggggtggggaagatcatcatgacggctgct
gccaagcacctgacccctgtcacgctggagctgggagggaagagtccctgctacgtggac
aagaactgtgacctggacgtggcctgccgacgcatcgcctgggggaaattcatgaacagt
ggccagacctgcgtggcccctgactacatcctctgtgacccctcgatccagaaccaaatt
gtggagaagctcaagaagtcactgaaagagttctacggggaagatgctaagaaatcccgg
gactatggaagaatcattagtgcccggcacttccagagggtgatgggcctgattgagggc
cagaaggtggcttatgggggcaccggggatgccgccactcgctacatagcccccaccatc
ctcacggacgtggacccccagtccccggtgatgcaagaggagatcttcgggcctgtgctg
cccatcgtgtgcgtgcgcagcctggaggaggccatccagttcatcaaccagcgtgagaag
cccctggccctctacatgttctccagcaacgacaaggtgattaagaagatgattgcagag
acatccagtggtggggtggcggccaacgatgtcatcgtccacatcaccttgcactctctg
cccttcgggggcgtggggaacagcggcatgggatcctaccatggcaagaagagcttcgag
actttctctcaccgccgctcttgcctggtgaggcctctgatgaatgatgaaggcctgaag
gtcagataccccccgagcccggccaagatgacccagcactga

DBGET integrated database retrieval system