KEGG   Homo sapiens (human): 220359
Entry
220359            CDS       T01001                                 
Symbol
TIGD3
Name
(RefSeq) tigger transposable element derived 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HTH_Tnp_Tc5 DDE_1 CENP-B_N HTH_23 HTH_3 HTH_28 MarR_2 HTH_26 HTH_37 HTH_Tnp_ISL3 Sigma70_r4 Trp_repressor HTH_5 TnsD HTH_24 HTH_31 HTH_Tnp_4 HTH_7 MRP-L20
Other DBs
NCBI-GeneID: 220359
NCBI-ProteinID: NP_663771
OMIM: 619084
HGNC: 18334
Ensembl: ENSG00000173825
UniProt: Q6B0B8
Position
11:65354751..65357613
AA seq 471 aa
MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWC
SGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMGQDFVPS
IGWLVRWKRRNNVGFGARHVLAPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPL
LYRAVPGSFGACDQVQVLLCANSRGTEKRRVLLGGLQAAPRCFFGIRSEALPASYHPDLG
IPWLEWLAQFDRDMGQQGRQVALLLAARVVEELAGLPGLYHVKLLPLAASSTTPPLPSSV
VRAFKAHYRHRLLGKLAAIQSERDGTSLAEAGAGITVLDALHVASAAWAKVPPQLIFSSF
IQEGLAPGKTPPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGD
REGAFEPLPTKADALRALGTLRRWFECNSTSPELFEKFYDCEEEVERLCCL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggagctgagcagcaagaagaagcttcacgccctgtccctggccgagaagatccaggtg
ctggaactcctggatgagtccaagatgtcccagtcggaggtggcccggcgcttccaggtt
tcccagccccagatctcgcgcatctgcaagaataaggagaagctgctggcggactggtgc
agcggcacagccaaccgagagcgcaagcgcaagcgggagtccaagtacagcgggatcgac
gaggctctgctctgctggtaccacattgcccgggccaaggcctgggacgtgacggggccc
atgctgctccacaaagccaaggagctggccgatatcatgggccaggacttcgtgcccagc
atcggctggctggtccgctggaaacgccgaaacaacgtcggctttggggcccgccatgtt
cttgcgccttcattcccccctgagccacctcccccggggctcacatcccaggctcagctg
cctctttccctaaaagacttctctccagaggacgtgtttggctgtgctgaattgcccttg
ctgtatcgggcagtgcccggcagctttggtgcatgtgatcaagtacaggtgctgctgtgt
gccaacagcaggggcaccgagaagcggcgggtactgctgggtgggctccaggctgccccg
agatgcttctttgggatccgcagtgaggctctgcctgcctcctaccacccggacctgggc
atcccctggttagagtggttggcacagtttgaccgggacatgggacagcagggccgacag
gtggctttgctgctggctgcccgagtggtggaggagctggcaggcctgcctgggctctac
cacgtgaagctcttgcctctggccgcctctagcaccacgcctcccctgcccagctcagtg
gtccgggcctttaaggcccattaccgacaccggctgttgggcaaactggctgccatccaa
agcgagagggatggcacctcgctggccgaggccggggcaggcatcaccgtgctggacgcc
ctgcacgtggcgtctgccgcctgggccaaggtgcctcctcagctcattttcagcagcttc
attcaagaagggctggctcccggcaaaacgcccccgtcctcgcacaaaacctctgagatg
ccaccagtccccggcgggctgagcctggaggagttttcccgctttgtggacctggagggt
gaggagccaaggtctggagtatgtaaggaggagataggcactgaagacgagaagggggac
agagagggtgcctttgagcccctgcccaccaaagctgatgccctccgggccctgggcacc
ttgaggaggtggtttgaatgcaacagcacttctcctgagctattcgaaaaattctacgac
tgtgaggaggaggtggagcggctttgctgcctatga

DBGET integrated database retrieval system