KEGG   Homo sapiens (human): 220992
Entry
220992            CDS       T01001                                 

Gene name
ZNF485
Definition
(RefSeq) zinc finger protein 485
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_11 zf-C2H2_6 zf_UBZ zinc_ribbon_15 tRNA-synt_2d
Other DBs
NCBI-GeneID: 220992
NCBI-ProteinID: NP_001305069
HGNC: 23440
Ensembl: ENSG00000198298
Vega: OTTHUMG00000018040
Pharos: Q8NCK3(Tdark)
UniProt: Q8NCK3 A0A024R7T5
Position
10q11.21
AA seq 441 aa
MAPRAQIQGPLTFGDVAVAFTRIEWRHLDAAQRALYRDVMLENYGNLVSVGLLSSKPKLI
TQLEQGAEPWTEVREAPSGTHAVEDYWFETKMSALKQSTSEASVLGERTKSVMMEKGLDW
EGRSSTEKNYKCKECGKVFKYNSSFISHQRNHTSEKPHKCKECGIAFMNSSSLLNHHKVH
AGKQPYRCIECGKFLKKHSTFINHQRIHSREKPHKCIECGKTFRKNSILLSHQRIHTGQK
PYKCNDCGKAFAQNAALTRHERIHSGEKPFKCNKCGRAFRDNSTVLEHQKIHTGEKPYQC
NECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQKTHSGNKPYQCRDCG
KAFTKSSTLTGHQRIHTGEKPYHCKKCGKAFRHSSGLVEHQRLHTGEKPYKCNECGKAFP
RSSALKQHKKIHNKERAMKCS
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggccccaagagcccagatccagggaccgctgacatttggggatgtggctgtggccttt
acccggattgagtggagacacctggatgctgctcagcgggccctgtacagggatgtgatg
ctggagaactatgggaatctggtgtctgtggggcttctctcttccaaaccaaaactaatt
actcagttggagcaaggggcagagccctggactgaggtgcgagaggctccatcaggcaca
catgcagtcgaggattactggtttgaaacaaagatgtcagccctaaagcaaagcacttct
gaagcatctgttctgggagagcgaacgaaaagtgtcatgatggaaaaaggcctggactgg
gagggcagaagctccacagagaagaactataagtgcaaggaatgtgggaaagtcttcaaa
tacaattcgtcctttattagccaccagagaaatcacaccagtgagaaaccacataaatgt
aaagaatgtgggatcgcctttatgaacagttcatcccttttaaatcaccataaggttcat
gcaggcaaacagccttatagatgtattgaatgtgggaagttcctgaagaagcactcaacg
tttatcaaccatcagagaattcattctagggagaaaccccacaaatgcattgaatgtgga
aaaactttcagaaagaactcaatccttttaagtcatcagagaattcatactggccagaaa
ccctacaaatgtaatgactgtgggaaagccttcgctcagaatgcagctcttactcgtcat
gaaagaatacatagtggagagaagccttttaaatgtaacaagtgtgggagagctttcagg
gataattcaactgtgttggaacatcagaaaatccatactggtgagaagccatatcagtgt
aatgaatgtggaaaagcctttaggaagagctcaactcttattagtcaccaaagaatgcat
actggggagaaaccctatcactgcagtaaatgtggaaaatctttcaggtatagctcatcc
tttgctggtcatcagaaaactcacagtggaaataaaccgtatcagtgtcgtgactgtggg
aaggcctttacaaagagctcaacccttactggacatcagagaattcatactggagaaaaa
ccctatcactgtaagaaatgtgggaaagcctttcggcacagctcaggccttgttgaacat
cagagactccatactggggaaaaaccttataaatgtaatgaatgtgggaaagcttttccc
cgaagttcagcccttaagcaacataagaaaattcataataaagaaagagccatgaaatgt
agttag

DBGET integrated database retrieval system