KEGG   Homo sapiens (human): 221078
Entry
221078            CDS       T01001                                 
Symbol
NSUN6, 4933414E04Rik, ARL5B-AS1, MRT82, NOPD1
Name
(RefSeq) NOP2/Sun RNA methyltransferase 6
  KO
K21971  methyltransferase NSUN6 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    221078 (NSUN6)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    221078 (NSUN6)
SSDB
Motif
Pfam: Methyltr_RsmB-F Methyltransf_31 FtsJ PUA PCMT BMT5-like Ubie_methyltran Methyltransf_23
Other DBs
NCBI-GeneID: 221078
NCBI-ProteinID: NP_872349
OMIM: 617199
HGNC: 23529
Ensembl: ENSG00000241058
UniProt: Q8TEA1
Structure
Position
10:complement(18545561..18659327)
AA seq 469 aa
MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTH
LASVQHVKNLLLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQC
GNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELS
RKEIFSGLPELKGMGIRMTEPVYLSPSFDSVLPRYLFLQNLPSALVSHVLNPQPGEKILD
LCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNSIRAFCFDGTKAVKL
DMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPLQRKLFTAAVQ
LLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ
LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtctattttccctaagatatctttgagacctgaggttgaaaactatcttaaggaaggc
tttatgaataaggagattgtgactgctttaggtaaacaagaagcagaaaggaagtttgaa
actttgttaaagcacctgtcacatcctccatcatttacaactgtcagagtgaatacacat
ttagcctcagtacaacatgtgaaaaatctgttacttgatgaacttcagaagcagtttaat
ggattaagtgttcctattcttcaacatccagaccttcaagatgtgttacttattcctgtt
attggacccagaaagaatattaaaaaacaacagtgtgaagccattgttggagcccagtgt
ggcaatgcagttttaagaggagcccatgtctatgccccaggaattgtgtcagcatcacaa
tttatgaaagctggagatgttatttctgtatactctgatattaaaggaaaatgtaagaaa
ggagccaaagaatttgatggaacaaaagtatttcttggaaatgggatttctgaactaagc
cgcaaagaaatcttcagtggattacctgaactgaaaggcatgggcataagaatgacagaa
ccagtatatctcagcccttcatttgacagtgtactgccccgttacttatttttacaaaat
ttgccatctgccttagtaagtcatgtactaaatcctcaacctggagagaagattctagac
ttgtgtgcagcacctggagggaaaacaacacacattgcagcactaatgcatgatcaggga
gaagttatagcactggataaaatcttcaacaaagtagaaaaaatcaaacagaatgcctta
ttgttagggctgaattccatcagggcattttgttttgatggaacaaaggcggttaaactt
gatatggtggaggacacagaaggagaacctccatttctaccagaatcctttgaccgaatt
cttctggatgcaccctgtagtggaatgggacagagaccaaacatggcctgtacttggtct
gtgaaggaagtggcatcatatcagccattacagcgaaaactcttcactgcagcggttcag
ctgctgaagccagagggtgtgctggtttatagcacgtgcactataacactggccgaaaat
gaagaacaggttgcctgggccctgacaaaatttccttgccttcagcttcagccccaggaa
ccgcagattggaggagaaggaatgaggggagctgggctctcatgtgaacagttgaaacag
ctgcagcgatttgatccatcggctgtgccattaccggacactgacatggactctcttaga
gaggccagaagagaagacatgttgcgtctggctaataaggactctataggtttttttatt
gcaaaatttgtaaaatgcaaaagcacatag

DBGET integrated database retrieval system