KEGG   Homo sapiens (human): 2220
Entry
2220              CDS       T01001                                 

Gene name
FCN2, EBP-37, FCNL, P35, ficolin-2
Definition
(RefSeq) ficolin 2
  KO
K10104  ficolin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    2220 (FCN2)
Lectins [BR:hsa04091]
 Ficolins
  2220 (FCN2)
SSDB
Motif
Pfam: Fibrinogen_C Collagen
Other DBs
NCBI-GeneID: 2220
NCBI-ProteinID: NP_004099
OMIM: 601624
HGNC: 3624
Ensembl: ENSG00000160339
Vega: OTTHUMG00000020892
Pharos: Q15485(Tbio)
UniProt: Q15485
Structure
PDB: 

Position
9q34.3
AA seq 313 aa
MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPG
PKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
IYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNI
HALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNN
QSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYN
YSYKVSEMKVRPA
NT seq 942 nt   +upstreamnt  +downstreamnt
atggagctggacagagctgtgggggtcctgggcgctgccaccctgctgctctctttcctg
ggcatggcctgggctctccaggcggcagacacctgtccagaggtgaagatggtgggcctg
gagggctctgacaagctcaccattctccgaggctgtccggggctgcctggggcccctggg
cccaagggagaggcaggcaccaatggaaagagaggagaacgtggcccccctggacctcct
gggaaggcaggaccacctgggcccaacggagcacctggggagccccagccgtgcctgaca
ggcccgcgtacctgcaaggacctgctagaccgagggcacttcctgagcggctggcacacc
atctacctgcccgactgccggcccctgactgtgctctgtgacatggacacggacggaggg
ggctggaccgttttccagcggagggtggatggctctgtggacttctaccgggactgggcc
acgtacaagcagggcttcggcagtcggctgggggagttctggctggggaatgacaacatc
cacgccctgaccgcccagggaaccagcgagctccgtgtagacctggtggactttgaggac
aactaccagtttgctaagtacagatcattcaaggtggccgacgaggcggagaagtacaat
ctggtcctgggggccttcgtggagggcagtgcgggagattccctgacgttccacaacaac
cagtccttctccaccaaagaccaggacaatgatcttaacaccggaaattgtgctgtgatg
tttcagggagcttggtggtacaaaaactgccatgtgtcaaacctgaatggtcgctacctc
agggggactcatggcagctttgcaaatggcatcaactggaagtcggggaaaggatacaat
tatagctacaaggtgtcagagatgaaggtgcgacctgcctag

DBGET integrated database retrieval system