KEGG   Homo sapiens (human): 2224Help
Entry
2224              CDS       T01001                                 

Gene name
FDPS, FPPS, FPS, POROK9
Definition
(RefSeq) farnesyl diphosphate synthase
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa05164  Influenza A
hsa05166  HTLV-I infection
Module
hsa_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Disease
H01933  Porokeratosis
Drug target
Alendronic acid (DG00783): D00939 D07119
Ibandronic acid (DG00785): D04486 D08056
Incadronic acid (DG01266): D07123 D08073
Minodronic acid hydrate: D09198
Pamidronic acid (DG00782): D00941 D07281
Risedronic acid (DG00786): D00942 D03234 D08484
Zoledronic acid (DG00787): D01968 D06378 D06379 D08689 D10515
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    2224 (FDPS)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    2224 (FDPS)
   05164 Influenza A
    2224 (FDPS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     2224 (FDPS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     2224 (FDPS)
Prenyltransferases [BR:hsa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   2224 (FDPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 2224
NCBI-ProteinID: NP_001129293
OMIM: 134629
HGNC: 3631
Ensembl: ENSG00000160752
Vega: OTTHUMG00000013909
Pharos: P14324(Tclin)
UniProt: P14324
Structure
PDB: 

Position
1q22
AA seq 419 aa AA seqDB search
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtcccgctggttgagatctgtgggggtcttcctgctgccagccccctactgg
gcaccccgggagaggtggctgggttccctacggcggccctccctggtgcacgggtaccca
gtcctggcctggcacagtgcccgctgctggtgccaagcgtggacagaggaacctcgagcc
ctttgctcctccctcagaatgaacggagaccagaattcagatgtttatgcccaagaaaag
caggatttcgttcagcacttctcccagatcgttagggtgctgactgaggatgagatgggg
cacccagagataggagatgctattgcccggctcaaggaggtcctggagtacaatgccatt
ggaggcaagtataaccggggtttgacggtggtagtagcattccgggagctggtggagcca
aggaaacaggatgctgatagtctccagcgggcctggactgtgggctggtgtgtggaactg
ctgcaagctttcttcctggtggcagatgacatcatggattcatcccttacccgccgggga
cagatctgctggtatcagaagccgggcgtgggtttggatgccatcaatgatgctaacctc
ctggaagcatgtatctaccgcctgctgaagctctattgccgggagcagccctattacctg
aacctgatcgagctcttcctgcagagttcctatcagactgagattgggcagaccctggac
ctcctcacagccccccagggcaatgtggatcttgtcagattcactgaaaagaggtacaaa
tctattgtcaagtacaagacagctttctactccttctaccttcctatagctgcagccatg
tacatggcaggaattgatggcgagaaggagcacgccaatgccaagaagatcctgctggag
atgggggagttctttcagattcaggatgattaccttgacctctttggggaccccagtgtg
accggcaaaattggcactgacatccaggacaacaaatgcagctggctggtggttcagtgt
ctgcaacgggccactccagaacagtaccagatcctgaaggaaaattacgggcagaaggag
gctgagaaagtggcccgggtgaaggcgctatatgaggagctggatctgccagcagtgttc
ttgcaatatgaggaagacagttacagccacattatggctctcattgaacagtacgcagca
cccctgcccccagccgtctttctggggcttgcgcgcaaaatctacaagcggagaaagtga

DBGET integrated database retrieval system