KEGG   Homo sapiens (human): 22854Help
Entry
22854             CDS       T01001                                 

Gene name
NTNG1, Lmnt1
Definition
(RefSeq) netrin G1
  KO
K07522  netrin-G1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22854 (NTNG1)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    22854 (NTNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 22854
NCBI-ProteinID: NP_001106697
OMIM: 608818
HGNC: 23319
Ensembl: ENSG00000162631
Vega: OTTHUMG00000010965
Pharos: Q9Y2I2(Tbio)
UniProt: Q9Y2I2 Q5IEC3 Q5IEC8
Structure
PDB: 

Position
1p13.3
AA seq 539 aa AA seqDB search
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgattcatgccctttgggttacggtgtcctcagtgatg
cagccctaccctttggtttggggacattatgatttgtgtaagactcagatttacacggaa
gaagggaaagtttgggattacatggcctgccagccggaatccacggacatgacaaaatat
ctgaaagtgaaactcgatcctccggatattacctgtggagaccctcctgagacgttctgt
gcaatgggcaatccctacatgtgcaataatgagtgtgatgcgagtacccctgagctggca
cacccccctgagctgatgtttgattttgaaggaagacatccctccacattttggcagtct
gccacttggaaggagtatcccaagcctctccaggttaacatcactctgtcttggagcaaa
accattgagctaacagacaacatagttattacctttgaatctgggcgtccagaccaaatg
atcctggagaagtctctcgattatggacgaacatggcagccctatcagtattatgccaca
gactgcttagatgcttttcacatggatcctaaatccgtgaaggatttatcacagcatacg
gtcttagaaatcatttgcacagaagagtactcaacagggtatacaacaaatagcaaaata
atccactttgaaatcaaagacaggttcgcgttttttgctggacctcgcctacgcaatatg
gcttccctctacggacagctggatacaaccaagaaactcagagatttctttacagtcaca
gacctgaggataaggctgttaagaccagccgttggggaaatatttgtagatgagctacac
ttggcacgctacttttacgcgatctcagacataaaggtgcgaggaaggtgcaagtgtaat
ctccatgccactgtatgtgtgtatgacaacagcaaattgacatgcgaatgtgagcacaac
actacaggtccagactgtgggaaatgcaagaagaattatcagggccgaccttggagtcca
ggctcctatctccccatccccaaaggcactgcaaatacctgtatccccagtatttccagt
attggtaattgtgaatgcttcggccactccaatcgatgcagttatatcgatctgctaaat
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacaactggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacaacagggcctaagtgtgatgagtgtctgccgggaaattcctggcactac
ggctgtcaaccgaatgtctgcgacaacgagctcctgcactgccagaacggagggacgtgc
cacaacaacgtgcgctgcctgtgcccggccgcatacacgggcatcctctgcgagaagctg
cggtgcgaggaggctggcagctgcggctccgactctggccagggcgcgcccccgcacggc
tccccagcgctgctgctgctgaccacgctgctgggaaccgccagccccctggtgttctag

DBGET integrated database retrieval system