KEGG   Homo sapiens (human): 22854Help
Entry
22854             CDS       T01001                                 

Gene name
NTNG1, Lmnt1
Definition
(RefSeq) netrin G1
  KO
K07522  netrin-G1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22854 (NTNG1)
 Organismal Systems
  Development
   04360 Axon guidance
    22854 (NTNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 22854
NCBI-ProteinID: NP_001106697
OMIM: 608818
HGNC: 23319
Ensembl: ENSG00000162631
Vega: OTTHUMG00000010965
Pharos: Q9Y2I2(Tbio)
UniProt: Q9Y2I2 Q5IEC8 Q5IEC3
Structure
PDB: 

Position
1p13.3
AA seq 539 aa AA seqDB search
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgattcatgccctttgggttacggtgtcctcagtgatg
cagccctaccctttggtttggggacattatgatttgtgtaagactcagatttacacggaa
gaagggaaagtttgggattacatggcctgccagccggaatccacggacatgacaaaatat
ctgaaagtgaaactcgatcctccggatattacctgtggagaccctcctgagacgttctgt
gcaatgggcaatccctacatgtgcaataatgagtgtgatgcgagtacccctgagctggca
cacccccctgagctgatgtttgattttgaaggaagacatccctccacattttggcagtct
gccacttggaaggagtatcccaagcctctccaggttaacatcactctgtcttggagcaaa
accattgagctaacagacaacatagttattacctttgaatctgggcgtccagaccaaatg
atcctggagaagtctctcgattatggacgaacatggcagccctatcagtattatgccaca
gactgcttagatgcttttcacatggatcctaaatccgtgaaggatttatcacagcatacg
gtcttagaaatcatttgcacagaagagtactcaacagggtatacaacaaatagcaaaata
atccactttgaaatcaaagacaggttcgcgttttttgctggacctcgcctacgcaatatg
gcttccctctacggacagctggatacaaccaagaaactcagagatttctttacagtcaca
gacctgaggataaggctgttaagaccagccgttggggaaatatttgtagatgagctacac
ttggcacgctacttttacgcgatctcagacataaaggtgcgaggaaggtgcaagtgtaat
ctccatgccactgtatgtgtgtatgacaacagcaaattgacatgcgaatgtgagcacaac
actacaggtccagactgtgggaaatgcaagaagaattatcagggccgaccttggagtcca
ggctcctatctccccatccccaaaggcactgcaaatacctgtatccccagtatttccagt
attggtaattgtgaatgcttcggccactccaatcgatgcagttatatcgatctgctaaat
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacaactggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacaacagggcctaagtgtgatgagtgtctgccgggaaattcctggcactac
ggctgtcaaccgaatgtctgcgacaacgagctcctgcactgccagaacggagggacgtgc
cacaacaacgtgcgctgcctgtgcccggccgcatacacgggcatcctctgcgagaagctg
cggtgcgaggaggctggcagctgcggctccgactctggccagggcgcgcccccgcacggc
tccccagcgctgctgctgctgaccacgctgctgggaaccgccagccccctggtgttctag

DBGET integrated database retrieval system