KEGG   Homo sapiens (human): 22997
Entry
22997             CDS       T01001                                 

Gene name
IGSF9B, LINC00947, MIR4697HG
Definition
(RefSeq) immunoglobulin superfamily member 9B
  KO
K22656  immunoglobulin superfamily member 9B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    22997 (IGSF9B)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  IGSF9
   22997 (IGSF9B)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set fn3 Ig_4 C2-set_2 Pur_ac_phosph_N Tissue_fac
Other DBs
NCBI-GeneID: 22997
NCBI-ProteinID: NP_001264214
OMIM: 613773
HGNC: 32326
Ensembl: ENSG00000080854
Vega: OTTHUMG00000167124
Pharos: Q9UPX0(Tdark)
UniProt: Q9UPX0 Q8N7W7
Position
11q25
AA seq 1437 aa
MIWYVATFIASVIGTRGLAAEGAHGLREEPEFVTARAGESVVLRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLL
GASGKYQVSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWN
KDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSALPSGSLQFRALSK
EDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVQVSMTTANVSWEPGYDGGYEQT
FSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSAFSEVVTVN
TLAFPITTPEPLVLVTPPRCLIANRTQQGVLLSWLPPANHSFPIDRYIMEFRVAERWELL
DDGIPGTEGEFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTDIFPQPDLTEDGLA
RPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCRKSLESPLSSG
KVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAE
AEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPL
VPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPGGLEGRLQATGQARPPAPRP
FHHGQYYGYLSSSSPGEVEPPPFYVPEVGSPLSSVMSSPPLPTEGPFGHPTIPEENGENA
SNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGL
PPTSLQVPAAYPGILSLEAPKGWAGKSPGRGPVPAPPAAKWQDRPMQPLVSQGQLRHTSQ
GMGIPVLPYPEPAEPGAHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVLQPSR
LSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSTGSPSQ
SSRSGSPSYRPAMGFTTLATGYPSPPPGPAPAGPGDSLDVFGQTPSPRRTGEELLRPETP
PPTLPTSGTLPPAPGNAAAPERLEALKYQRIKKPKKSSKGSSKSKKRSDDSASQTQQLPN
SQVLWPDEAVCLRKKKRHSRPDPFARLSDLCHRQLPEDQTAILNSVDHDDPGHATLL
NT seq 4314 nt   +upstreamnt  +downstreamnt
atgatttggtatgtggccactttcatagcaagtgtgatcggcacccgagggcttgcggct
gaaggcgcccacggcctgcgagaggagcccgagtttgtgacggcaagagctggggagagc
gtggtcctgcgatgcgacgtgatccacccagtgacgggacagcccccaccctatgtcgta
gagtggttcaagttcggggtccccatccctatcttcatcaagtttggctactacccgccg
cacgtggaccctgagtatgcaggccgggccagtcttcatgataaggcatctctgcggctg
gaacaagttcgctctgaggaccagggctggtatgagtgcaaagtgctcatgctggaccag
cagtatgacaccttccacaatggcagctgggtccacctcaccatcaacgcccctcccacc
tttacagaaacacccccccagtacatcgaggccaaggagggtggtagtatcaccatgacc
tgcacagcttttgggaaccccaagcccattgtcacctggctcaaggaggggacgctcctc
ggtgctagtgggaaataccaggtgagtgacggcagcctgacagtgacatcggtcagtcgg
gaggacagaggtgcctacacctgccgagcgtacagcattcagggggaggctgtccacacg
actcacctgcttgtccaagggccccctttcatcgtctcccctcctgagaacatcaccgtc
aacatctcccaggatgctctgctcacctgccgggcagaggcgtatccgggcaacctcacc
tacacctggtactggcaggacgagaacgtctactttcagaacgacctgaagctgagggtg
cgcatcctaatcgatgggaccctgatcatcttccgggtgaagccggaggactcggggaag
tacacctgtgtgcccagcaacagcctggggcgctccccctccgcctcggcgtacctgacc
gtgcagtacccagcgcgtgtcctcaacatgccccctgtgatttacgtgcccgtggggatc
catggctacatccgctgccctgtggacgcagaaccaccggccaccgtggtcaagtggaac
aaggacggccgtcccctgcaggttgagaagaacctcggttggaccctgatggaggatggc
tccattcgaattgaggaggccacagaggaggctcttggcacttatacctgtgtgccttac
aacactctggggaccatgggccagtctgcccctgcgaggcttgtcctgaaggaccccccc
tatttcacggtgctaccaggctgggagtacaggcaggaggccggccgggagctacttatc
ccctgtgctgccgcaggggacccctttcctgtcatcacttggagaaaggtagggaagccc
agcagaagcaagcacagtgccctgcccagtgggagcctgcagttccgtgccctgagtaag
gaggaccacggggagtgggaatgtgtcgccaccaacgtggtcacgagcatcactgccagc
acccacctcaccgtcatcggcaccagcccccatgccccgggcagtgtccgggtccaggtc
tccatgacaactgccaacgtgtcctgggaaccaggctatgatggaggctacgagcagaca
ttctcagtttggatgaagcgggcacagtttgggccccatgactggctgtccttgccagtg
ccgccaggacccagctggctgctggtggacaccctggagcctgagacagcgtaccagttc
agcgtcctggcccagaacaagctgggaaccagcgccttcagtgaggtggtcactgtgaac
actttagcattccctattacaactccagaacccctggtgctggtcaccccaccgaggtgc
ctcatagccaatcggactcagcagggtgtgctcctgtcctggcttccgcctgccaaccac
agctttcccatcgaccgctacatcatggagttccgtgtcgcagagcgctgggagttgctc
gacgatggcatccccggcaccgaaggagagttctttgccaaggatctgtcacaggacacg
tggtatgagttccgggttctggccgtcatgcaggatctgatcagcgagcccagcaacatc
gccggcgtctccagcacagacatcttcccgcagccggacctgaccgaggatgggctggcg
cggcctgtgctggcgggaatcgtagctaccatctgcttcttggcagctgccatcctgttc
agcaccctggctgcctgctttgtcaacaagcagcgcaagcgtaagctcaagcgcaaaaaa
gaccctccactctccatcacccactgcaggaagagcctggagtctcccttgtcctctggc
aaggtgagccccgagagcatccgcacgctccgagcgccgtcagaatcctccgacgaccag
ggccagcccgcggccaagaggatgctgagccccacccgtgagaaggagctgtcgctgtac
aagaagaccaagcgggccatcagcagcaagaagtacagcgtggccaaggcagaggccgag
gcagaggccaccacgcccatcgagctcatcagcagaggccctgacggccgcttcgtgatg
gaccctgccgagatggagccctcgctgaagagcaggcgcatcgagggcttccccttcgcc
gaggagacggacatgtaccccgagttccgccagtcggacgaggagaacgaggacccactg
gtgcccacatctgtggccgccctgaagtcccagctcacccctctgtcatccagccaggag
tcctacctgccaccaccagcatacagccctcggttccagccccgcgggctggagggcccc
ggtggcctggaaggtcggcttcaggccacaggccaggcccggccccctgccccccggccc
ttccaccatggccagtattatgggtacctcagcagcagcagccctggggaggtggagccg
cccccgttctacgtgccagaagtgggcagccccctgagctccgtcatgtcgtccccgccc
ctgcccaccgaggggccctttggccaccccaccatccccgaggagaatggagagaatgca
tccaacagcacgctgcccttgactcagacacctacaggagggcgctcccctgagccctgg
ggccggccagaattccccttcggggggctggagaccccagcgatgatgttcccccaccag
ctgccaccctgtgatgtgcccgagagtctgcagcccaaggccggcctcccccgaggactg
ccccccacctccctgcaggtgcccgcggcctacccgggcatcctgtctctggaggcaccg
aagggttgggcaggcaagtcgcccggcaggggccctgtcccagcgccccccgccgccaag
tggcaggacagacctatgcaacctctggtaagccaagggcagctgcgacatacaagccaa
ggcatgggcatacctgtgctgccttaccccgagccggctgagccgggggcgcacggcggc
cccagcacatttggcctggacacccggtggtatgagccccagccccggccccggcctagc
cctcggcaggccaggcgcgccgagcccagtttacatcaagtggtgctacagccctcccgg
ctctcacctctgacccaaagccccctcagctcccgcaccggctcccctgagctcgccgcc
cgtgcccggcctcgcccgggcctcctgcagcaggcagagatgtcagagatcaccctgcag
ccgccggctgcagtcagcttttctcgaaagtctacgccgtccacaggctccccctcccag
agcagccgcagtgggagtcccagctaccggcccgccatgggcttcaccactctggccacc
ggctacccttcccctccacccggccccgcccctgctgggcctggggacagcttggacgtg
tttggacagacgccttcccctcgaaggacgggggaggaattgctccgaccggagacccca
ccacccacgttacctacttcaggaacacttccacctgcacccgggaacgctgctgcgcct
gagaggctggaggctctgaaataccaacggataaagaagcccaaaaagtcatccaagggc
tcttcgaagtcaaagaaacgatccgacgattctgcctcccagactcagcagcttcccaac
tctcaggttctgtggcccgatgaagctgtctgcctccgaaagaagaagagacattctcgt
cctgacccctttgcccggctctcagacttgtgccaccgccagcttccggaagaccagaca
gcgattctcaacagtgtggaccacgatgacccaggacatgccactttgctgtga

DBGET integrated database retrieval system