KEGG   Homo sapiens (human): 2321Help
Entry
2321              CDS       T01001                                 

Gene name
FLT1, FLT, FLT-1, VEGFR-1, VEGFR1
Definition
(RefSeq) fms related tyrosine kinase 1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05202  Transcriptional misregulation in cancer
hsa05323  Rheumatoid arthritis
Network
N00141  PAX3-FOXO1 fusion to transcriptional activation
Drug target
Axitinib: D03218
Cabozantinib (DG01670): D10062 D10095
Cediranib (DG01360): D08881 D08883
Dovitinib lactate: D08907
Icrucumab: D09926
Ilorasertib: D10423
Lenvatinib (DG01362): D09919 D09920
Linifanib: D09635
Motesanib (DG01262): D06678 D08947
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Sitravatinib: D11140
Sunitinib (DG00712): D06402 D08552
Tivozanib (DG01375): D09683 D10190
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2321 (FLT1)
   04015 Rap1 signaling pathway
    2321 (FLT1)
   04010 MAPK signaling pathway
    2321 (FLT1)
   04066 HIF-1 signaling pathway
    2321 (FLT1)
   04151 PI3K-Akt signaling pathway
    2321 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2321 (FLT1)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    2321 (FLT1)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    2321 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2321 (FLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2321 (FLT1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   2321 (FLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD Ig_6 Ig_4 C1-set Ig_5 C2-set_2 Haspin_kinase Adeno_E3_CR1 Marek_A
Motif
Other DBs
NCBI-GeneID: 2321
NCBI-ProteinID: NP_002010
OMIM: 165070
HGNC: 3763
Ensembl: ENSG00000102755
Vega: OTTHUMG00000016648
Pharos: P17948(Tclin)
UniProt: P17948 L7RSL3
Structure
PDB: 

Position
13q12.3
AA seq 1338 aa AA seqDB search
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagtgatcacacagtggccatcagcagttccaccacttta
gactgtcatgctaatggtgtccccgagcctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggctctgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctcctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
ccagatgaagttcctttggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacgtgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctaaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctctccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcactacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagcgtc
accagcagcgaaagctttgcgagctccggctttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgacggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttccagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaacgtggtgaagatttgtgat
tttggccttgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatctttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggtgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactaggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaagtatttcagct
ccgaagtttaattcaggaagctctgatgatgtcagatacgtaaatgctttcaagttcatg
agcctggaaagaatcaaaacctttgaagaacttttaccgaatgccacctccatgtttgat
gactaccagggcgacagcagcactctgttggcctctcccatgctgaagcgcttcacctgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtaaccagtaaaagtaag
gagtcggggctgtctgatgtcagcaggcccagtttctgccattccagctgtgggcacgtc
agcgaaggcaagcgcaggttcacctacgaccacgctgagctggaaaggaaaatcgcgtgc
tgctccccgcccccagactacaactcggtggtcctgtactccaccccacccatctag

DBGET integrated database retrieval system