KEGG   Homo sapiens (human): 2321Help
Entry
2321              CDS       T01001                                 

Gene name
FLT1, FLT, FLT-1, VEGFR-1, VEGFR1
Definition
(RefSeq) fms related tyrosine kinase 1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05202  Transcriptional misregulation in cancer
hsa05323  Rheumatoid arthritis
Network
N00141  PAX3-FOXO1 fusion to transcriptional activation
Drug target
Axitinib: D03218
Cabozantinib (DG01670): D10062 D10095
Cediranib (DG01360): D08881 D08883
Dovitinib lactate: D08907
Icrucumab: D09926
Ilorasertib: D10423
Lenvatinib (DG01362): D09919 D09920
Linifanib: D09635
Motesanib (DG01262): D06678 D08947
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Sunitinib (DG00712): D06402 D08552
Tivozanib (DG01375): D09683 D10190
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2321 (FLT1)
   04015 Rap1 signaling pathway
    2321 (FLT1)
   04010 MAPK signaling pathway
    2321 (FLT1)
   04066 HIF-1 signaling pathway
    2321 (FLT1)
   04151 PI3K-Akt signaling pathway
    2321 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2321 (FLT1)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    2321 (FLT1)
  09162 Immune diseases
   05323 Rheumatoid arthritis
    2321 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2321 (FLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2321 (FLT1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   2321 (FLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Pkinase ig Ig_2 V-set C1-set Ig_4 Ig_5 C2-set_2 Haspin_kinase Adeno_E3_CR1 Marek_A
Motif
Other DBs
NCBI-GeneID: 2321
NCBI-ProteinID: NP_002010
OMIM: 165070
HGNC: 3763
Ensembl: ENSG00000102755
Vega: OTTHUMG00000016648
Pharos: P17948(Tclin)
UniProt: P17948 L7RSL3
Structure
PDB: 

Position
13q12.3
AA seq 1338 aa AA seqDB search
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagtgatcacacagtggccatcagcagttccaccacttta
gactgtcatgctaatggtgtccccgagcctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggctctgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctcctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
ccagatgaagttcctttggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacgtgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctaaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctctccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcactacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagcgtc
accagcagcgaaagctttgcgagctccggctttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgacggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttccagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaacgtggtgaagatttgtgat
tttggccttgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatctttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggtgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactaggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaagtatttcagct
ccgaagtttaattcaggaagctctgatgatgtcagatacgtaaatgctttcaagttcatg
agcctggaaagaatcaaaacctttgaagaacttttaccgaatgccacctccatgtttgat
gactaccagggcgacagcagcactctgttggcctctcccatgctgaagcgcttcacctgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtaaccagtaaaagtaag
gagtcggggctgtctgatgtcagcaggcccagtttctgccattccagctgtgggcacgtc
agcgaaggcaagcgcaggttcacctacgaccacgctgagctggaaaggaaaatcgcgtgc
tgctccccgcccccagactacaactcggtggtcctgtactccaccccacccatctag

DBGET integrated database retrieval system