KEGG   Homo sapiens (human): 23325
Entry
23325             CDS       T01001                                 
Symbol
WASHC4, KIAA1033, MRT43, SWIP
Name
(RefSeq) WASH complex subunit 4
  KO
K18465  WASH complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00768  Autosomal recessive intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23325 (WASHC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23325 (WASHC4)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   WASH complex
    23325 (WASHC4)
SSDB
Motif
Pfam: WASH-4_N WASH-7_mid WASH-7_C
Other DBs
NCBI-GeneID: 23325
NCBI-ProteinID: NP_056090
OMIM: 615748
HGNC: 29174
Ensembl: ENSG00000136051
Pharos: Q2M389(Tbio)
UniProt: Q2M389
Position
12:105107731..105169130
AA seq 1173 aa
MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFN
LDPIALKLLPYEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYG
EGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHITLKDHWTMYKRLLKSVHHNPSKFGIQEEK
LKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVE
AKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAITLTANIIWFP
DNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESIL
SKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLV
ELLKAIEHMFYRRSMVVADSVSHITQHLQHQALHSISVAKKRVISDKKYSEQRLDVLSAL
VLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQ
CDCCFLYWHRAVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESYEILLDCY
DKEIMEILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPFKVGMKDLALFFSLNPIRFFN
RFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQGL
DVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLG
VTPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDIVNFEELVKEE
GLAEETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPL
TLNFVEHSISCKEKLNKKNKIGAAFTDDGFAMGVAYILKLLDQYREFDSLHWFQSVREKY
LKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEFELLYFSLSSARIFFRADKTA
AEENQEKKEKEEETKTSNGDLSDSTVSADPVVK
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggcggtggagactctgtccccggactgggagtttgaccgcgttgacgacggctcgcag
aaaattcatgccgaagtccaacttaagaattatgggaaatttcttgaggagtatacctct
caactgagaagaattgaggacgctctggatgactcaattggagatgtttgggatttcaat
cttgatcctatagcattaaagcttttgccttatgaacagtcctctcttttggaactcata
aagactgaaaacaaggtcttaaacaaagtcatcactgtttatgctgcactttgttgtgaa
atcaagaaattaaaatatgaggctgaaactaaattttacaatggtctcttgttttatgga
gaaggagctacagatgccagcatggtggaaggtgattgccaaattcaaatggggagattt
atttcattcttacaggaactgtcttgctttgttacgaggtgctatgaagtggtgatgaac
gtagtccaccagttggctgccctctatatcagtaacaagattgcacccaaaattatagag
acaactggagttcattttcagactatgtatgagcacttgggagaactgctaacagttttg
ctcaccctggatgaaattattgataatcatatcacactgaaagaccactggactatgtac
aaaaggttactgaaatctgtccatcacaatccttcaaaatttggaattcaggaagaaaaa
ttaaagccatttgaaaagttcttgctgaagctagaagggcaattactggatggaatgata
ttccaggcctgtatagaacaacaatttgattctctcaatggaggagtatctgtgtcaaaa
aatagtacttttgctgaggaatttgcacatagtattcggtcaatttttgcaaatgtagaa
gccaaacttggagaaccttctgaaattgaccagagagacaagtatgttggaatttgtgga
ctctttgtattgcactttcagatttttcgaactattgataaaaagttttataagtcttta
ttggacatttgtaagaaggtaccagccatcactctaactgctaatattatttggtttcct
gataattttctgatccagaaaataccagcagctgccaaactgctagacagaaaaagtctt
caagccattaaaatacacagggatacttttctacaacagaaagctcaatcacttaccaaa
gatgtacagtcttactacgtctttgtgagctcatggatgatgaaaatggaatctattttg
tctaaagagcagagaatggataaatttgctgaagatctcaccaatagatgtaatgttttt
atacagggcttcttgtatgcatatagtattagtaccattattaaaaccacaatgaatctc
tacatgtccatgcaaaagccaatgaccaaaacctcagttaaggcattgtgcaggcttgtt
gaacttctcaaggcaatagagcatatgttctacaggagaagcatggttgtggctgattca
gtttcacatataacacagcaccttcaacatcaggctcttcattctatttctgtggccaag
aaaagagtgatttctgacaaaaaatacagcgaacagcgtcttgatgtgctctctgctcta
gttttggctgaaaacactctaaatggaccaagcacaaagcaacggcgacttattgtttct
ttggcactaagtgttggcacacaaatgaaaacatttaaagatgaagaactctttccactt
caagtagtcatgaaaaaactggatcttattagtgaacttagagaacgagtccaaacacaa
tgtgactgttgttttttatactggcatcgagctgtcttcccaatttatttagatgatgta
tatgaaaatgctgttgatgcagccagattacattacatgttcagtgctttgcgcgactgt
gtacctgctatgatgcatgcaaggcatttagagtcctatgagatacttctggattgctat
gacaaggaaattatggaaattttaaatgagcatttgctggacaaattatgcaaagaaata
gagaaagatctgcgactttctgtgcatactcatttaaagctggatgaccgaaaccctttc
aaagttggcatgaaagacctggctctttttttctctctgaatccaattcggtttttcaat
cgtttcattgacattcgggcttacgtaactcactacctagacaagactttctacaatcta
acaactgtagcccttcatgactgggccacttatagtgagatgagaaacttagctactcag
cgttatggactggttatgacagaggcacatcttcccagtcagactttggaacagggcctt
gatgttttagaaattatgagaaacattcatatatttgtgtcccgatacctctataatctc
aacaatcagatttttattgaacgaacaagcaataacaagcatttgaatactattaatatt
cggcatattgctaattcaattcgaacacatggcacgggaattatgaatacaactgttaat
ttcacctaccagtttttgaaaaagaagttctatatatttagccaatttatgtatgatgaa
cacatcaaatccagattgattaaagatattcgatttttcagggaaattaaggaccaaaat
gatcataagtatccttttgatagagcagaaaaattcaatcgaggcatcagaaaacttgga
gtaacacctgagggacagagctaccttgatcaattcaggcaactcatcagccagattggt
aatgctatgggctatgtacgaatgataagatctggtggtcttcattgtagcagcaatgcc
attagatttgttcctgatcttgaagatattgtaaattttgaagaactagtaaaagaagaa
ggtcttgcagaagaaacattaaaagcagcaaggcatttggattcagtcctcagtgatcac
acacgaaattctgccgaaggcacagaatatttcaaaatgcttgtagacgtttttgctcca
gaatttcgaaggccaaagaatatacatctccgaaatttctatataattgttccccctctg
accctcaactttgtagagcattccattagttgcaaggaaaaattaaataaaaaaaataaa
attggagctgcctttactgatgatggctttgccatgggtgtggcttacattctaaagctt
ttggatcagtatcgggagtttgattcacttcactggttccagtctgttagagagaaatac
ctgaaggagataagagcagttgctaagcaacagaatgtacagtcagccagtcaagatgaa
aaactcttacaaaccatgaatctcactcagaagcgactggatgtctatctacaggaattt
gaattgctgtatttctcactgagcagtgcaagaattttcttcagagcagacaagactgcg
gctgaagaaaaccaagaaaagaaagagaaggaagaagaaactaaaacaagcaatggagac
ctgtctgacagcactgtgtctgctgatcctgttgtgaaatga

DBGET integrated database retrieval system