KEGG   Homo sapiens (human): 23767Help
Entry
23767             CDS       T01001                                 

Gene name
FLRT3, HH21
Definition
(RefSeq) fibronectin leucine rich transmembrane protein 3
  KO
K16362  leucine-rich repeat transmembrane protein FLRT
Organism
hsa  Homo sapiens (human)
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    23767 (FLRT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_5 LRRNT fn3 LRRCT LRR_1 TPKR_C2
Motif
Other DBs
NCBI-GeneID: 23767
NCBI-ProteinID: NP_037413
OMIM: 604808
HGNC: 3762
Ensembl: ENSG00000125848
Vega: OTTHUMG00000031914
Pharos: Q9NZU0(Tbio)
UniProt: Q9NZU0
Structure
PDB: 

Position
20p12.1
AA seq 649 aa AA seqDB search
MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgcagcctggagcatcttcctcatcgggactaaaattgggctgttccttcaa
gtagcacctctatcagttatggctaaatcctgtccatctgtgtgtcgctgcgatgcgggt
ttcatttactgtaatgatcgctttctgacatccattccaacaggaataccagaggatgct
acaactctctaccttcagaacaaccaaataaataatgctgggattccttcagatttgaaa
aacttgctgaaagtagaaagaatatacctataccacaacagtttagatgaatttcctacc
aacctcccaaagtatgtaaaagagttacatttgcaagaaaataacataaggactatcact
tatgattcactttcaaaaattccctatctggaagaattacatttagatgacaactctgtc
tctgcagttagcatagaagagggagcattccgagacagcaactatctccgactgcttttc
ctgtcccgtaatcaccttagcacaattccctggggtttgcccaggactatagaagaacta
cgcttggatgataatcgcatatccactatttcatcaccatctcttcaaggtctcactagt
ctaaaacgcctggttctagatggaaacctgttgaacaatcatggtttaggtgacaaagtt
ttcttcaacctagttaatttgacagagctgtccctggtgcggaattccctgactgctgca
ccagtaaaccttccaggcacaaacctgaggaagctttatcttcaagataaccacatcaat
cgggtgcccccaaatgctttttcttatctaaggcagctctatcgactggatatgtccaat
aataacctaagtaatttacctcagggtatctttgatgatttggacaatataacacaactg
attcttcgcaacaatccctggtattgcgggtgcaagatgaaatgggtacgtgactggtta
caatcactacctgtgaaggtcaacgtgcgtgggctcatgtgccaagccccagaaaaggtt
cgtgggatggctattaaggatctcaatgcagaactgtttgattgtaaggacagtgggatt
gtaagcaccattcagataaccactgcaatacccaacacagtgtatcctgcccaaggacag
tggccagctccagtgaccaaacagccagatattaagaaccccaagctcactaaggatcac
caaaccacagggagtccctcaagaaaaacaattacaattactgtgaagtctgtcacctct
gataccattcatatctcttggaaacttgctctacctatgactgctttgagactcagctgg
cttaaactgggccatagcccggcatttggatctataacagaaacaattgtaacaggggaa
cgcagtgagtacttggtcacagccctggagcctgattcaccctataaagtatgcatggtt
cccatggaaaccagcaacctctacctatttgatgaaactcctgtttgtattgagactgaa
actgcaccccttcgaatgtacaaccctacaaccaccctcaatcgagagcaagagaaagaa
ccttacaaaaaccccaatttacctttggctgccatcattggtggggctgtggccctggtt
accattgcccttcttgctttagtgtgttggtatgttcataggaatggatcgctcttctca
aggaactgtgcatatagcaaagggaggagaagaaaggatgactatgcagaagctggcact
aagaaggacaactctatcctggaaatcagggaaacttcttttcagatgttaccaataagc
aatgaacccatctcgaaggaggagtttgtaatacacaccatatttcctcctaatggaatg
aatctgtacaaaaacaatcacagtgaaagcagtagtaaccgaagctacagagacagtggt
attccagactcagatcactcacactcatga

DBGET integrated database retrieval system