KEGG   Homo sapiens (human): 2444Help
Entry
2444              CDS       T01001                                 

Gene name
FRK, GTK, PTK5, RAK
Definition
(RefSeq) fyn related Src family tyrosine kinase
  KO
K08892  fyn-related kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2444 (FRK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2444 (FRK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2444 (FRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2444
NCBI-ProteinID: NP_002022
OMIM: 606573
HGNC: 3955
Ensembl: ENSG00000111816
Vega: OTTHUMG00000015424
Pharos: P42685(Tchem)
UniProt: P42685
Position
6q22.1
AA seq 505 aa AA seqDB search
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAED
LSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGA
IGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR
RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNV
LVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTF
ETLRWKLEDYFETDSSYSDANNFIR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatctgtcagaggctctgggagtacctagaaccctatctcccctgtttgtcc
acggaggcagacaagtcaaccgtgattgaaaatccaggggccctttgctctccccagtca
cagaggcatggccactactttgtggctttgtttgattaccaggctcggactgctgaggac
ttgagcttccgagcaggtgacaaacttcaagttctggacactttgcatgagggctggtgg
tttgccagacacttggagaaaagacgagatggctccagtcagcaactacaaggctatatt
ccttctaactacgtggctgaggacagaagcctacaggcagagccgtggttctttggagca
atcggaagatcagatgcagagaaacaactattatattcagaaaacaagaccggttccttt
ctaatcagagaaagtgaaagccaaaaaggagaattctctctttcagttttagatggagca
gttgtaaaacactacagaattaaaagactggatgaagggggattttttctcacgcgaaga
agaatcttttcaacactgaacgaatttgtgagccactacaccaagacaagtgacggcctg
tgtgtcaagctggggaaaccatgcttaaagatccaggtcccagctccatttgatttgtcg
tataaaaccgtggaccaatgggagatagaccgcaactccatacagcttctgaagcgattg
ggatctggtcagtttggcgaagtatgggaaggtctgtggaacaataccactccagtagca
gtgaaaacattaaaaccaggttcaatggatccaaatgacttcctgagggaggcacagata
atgaagaacctaagacatccaaagcttatccagctttatgctgtttgcactttagaagat
ccaatttatattattacagagttgatgagacatggaagtctgcaagaatatctccaaaat
gacactggatcaaaaatccatctgactcaacaggtagacatggcggcacaggttgcctct
ggaatggcctatctggagtctcggaactacattcacagagatctggctgccagaaatgtc
ctcgttggtgaacataatatctacaaagtagcagattttggacttgccagagtttttaag
gtagataatgaagacatctatgaatctagacacgaaataaagctgccggtgaagtggact
gcgcccgaagccattcgtagtaataaattcagcattaagtccgatgtatggtcatttgga
atccttctttatgaaatcattacttatggcaaaatgccttacagtggtatgacaggtgcc
caggtaatccagatgttggctcaaaactatagacttccgcaaccatccaactgtccacag
caattttacaacatcatgttggagtgctggaatgcagagcctaaggaacgacctacattt
gagacactgcgttggaaacttgaagactattttgaaacagactcttcatattcagatgca
aataacttcataagatga

DBGET integrated database retrieval system