KEGG   Homo sapiens (human): 247Help
Entry
247               CDS       T01001                                 

Gene name
ALOX15B, 15-LOX-2
Definition
(RefSeq) arachidonate 15-lipoxygenase type B
  KO
K08022  arachidonate 15-lipoxygenase (second type) / 8-lipoxygenase (S-type) [EC:1.13.11.33 1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    247 (ALOX15B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    247 (ALOX15B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     247 (ALOX15B)
    1.13.11.-  
     247 (ALOX15B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT DNA_pol3_tau_4
Motif
Other DBs
NCBI-GeneID: 247
NCBI-ProteinID: NP_001132
OMIM: 603697
HGNC: 434
Ensembl: ENSG00000179593
Vega: OTTHUMG00000108181
Pharos: O15296(Tchem)
UniProt: O15296
Structure
PDB: 

Position
17p13.1
AA seq 676 aa AA seqDB search
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcagggtcagggtgtccaccggagaagccttcggggctggcacatgggac
aaagtgtctgtcagcatcgtggggacccggggagagagccccccactgcccctggacaat
ctcggcaaggagttcactgcgggcgctgaggaggacttccaggtgacgctcccggaggac
gtaggccgagtgctgctgctgcgcgtgcacaaggcgcccccagtgctgcccctgctgggg
cccctggccccggatgcctggttctgccgctggttccagctgacaccgccgcggggcggc
cacctcctcttcccctgctaccagtggctggagggggcggggaccctggtgctgcaggag
ggtacagccaaggtgtcctgggcagaccaccaccctgtgctccagcaacagcgccaggag
gagcttcaggcccggcaggagatgtaccagtggaaggcttacaacccaggttggcctcac
tgcctggatgaaaagacagtggaagacttggagctcaatatcaaatactccacagccaag
aatgccaacttttatctacaggctggctctgcttttgcagagatgaaaatcaaggggttg
ctggaccgcaaggggctctggaggagtctgaatgagatgaaaaggatcttcaacttccgg
aggaccccagcagctgagcacgcatttgagcactggcaggaggacgccttcttcgcctcc
cagttcctgaatggtctcaaccctgtcctgatccgccgctgtcactacctcccaaagaac
ttccccgtcactgatgccatggtggcctcagtgttgggtcctgggaccagcttgcaggct
gagctagagaagggctccctgttcttggtggatcacggcatcctctctggcatccagacc
aatgtcattaatgggaagcctcagttctctgcggccccaatgaccctgctataccagagc
ccaggctgcgggccgctgctgcctctcgccatccagctcagccagacccccggcccaaac
agccccatcttcctgcccactgatgacaagtgggactggttgctggccaagacctgggtg
cgcaatgccgagttctccttccatgaggccctcacgcacctgctgcactcacatctgctg
cctgaggtcttcaccctggctaccctgcgtcagctgccccactgccaccctctcttcaag
ctgctgatcccgcacacccgatacaccctgcacatcaacacactcgcccgggagctgctt
atcgtgccagggcaggtggtggacaggtccacaggcatcggcattgaaggcttctctgag
ttgatacagaggaacatgaagcagctgaactattctctcctgtgtctgcctgaggatatc
cggacccgaggagttgaagacatcccaggctactactaccgtgatgatgggatgcagatc
tggggtgcagtggaacgctttgtctctgaaatcatcggtatctactacccaagtgatgag
tctgtccaagatgacagagagctccaggcctgggtcagagagatcttctccaagggcttc
ctaaaccaggagagctcaggtataccctcctcactggagacccgggaagccctggtgcag
tatgtcaccatggtgatattcacctgctccgccaagcatgcggctgtcagtgcagggcag
tttgactcctgtgcttggatgcccaacctgccacccagcatgcagctgccaccacccacc
tccaaaggcctggcaacatgcgagggcttcatagccaccctcccacctgtcaatgccaca
tgtgatgtcatccttgctctctggttgctgagcaaggagcctggagaccaaaggcccctg
ggcacctatccggatgagcacttcacagaggaggcccctcggcggagcatcgccaccttc
cagagccgcctggcccagatctcgaggggcatccaggagcggaaccagggcctggtgctg
ccctacacctacctagaccctcccctcatcgagaacagcgtctccatctaa

DBGET integrated database retrieval system