KEGG   Homo sapiens (human): 254887
Entry
254887            CDS       T01001                                 

Gene name
ZDHHC23, DHHC-23, NIDD
Definition
(RefSeq) zinc finger DHHC-type palmitoyltransferase 23
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    254887 (ZDHHC23)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     254887 (ZDHHC23)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 254887
NCBI-ProteinID: NP_775841
OMIM: 617334
HGNC: 28654
Ensembl: ENSG00000184307
Vega: OTTHUMG00000159335
Pharos: Q8IYP9(Tdark)
UniProt: Q8IYP9 B3KXV3
Position
3q13.31
AA seq 409 aa
MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKS
LQPETCERIMDTISDRLRIPWLRGAKKVNISIIPPLVLLPVFLHVASWHFLLGVVVLTSL
PVLALWYYYLTHRRKEQTLFFLSLGLFSLGYMYYVFLQEVVPKGRVGPVQLAVLTCGLFL
ILLALHRAKKNPGYLSNPASGDRSLSSSQLECLSRKGQEKTKGFPGADMSGSLNNRTTKD
DPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESN
HQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSALSFTCVWYSVI
ITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGLLG
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgacacagaagggcagtatgaagcctgtgaagaaaaagaaaaccgaagaacctgaattg
gagcccctgtgctgctgcgagtacatagatcggaatggggaaaagaaccacgtggctact
tgtttgtgtgattgtcaagatctggatgaagggtgtgatcgatggattacatgtaaatct
ttacagccagagacttgtgaaagaatcatggatacaatttctgatcgcctccgaattcct
tggcttaggggagccaaaaaagtgaacatcagcatcatccctccgcttgtcctgctgcct
gtcttccttcatgtggcttcctggcatttcctcctgggggtggtggttttgacctccctt
cctgtgctggcactgtggtactactacctcactcacagaaggaaagaacagaccctgttt
ttcctgagccttggactgttctctctgggctacatgtactatgtgttcctgcaggaagtg
gtccccaaagggcgtgtgggtcccgttcagctggcggttcttacctgcgggttatttctg
atactcttagccttgcacagagccaagaagaatccaggctacctcagcaatccagcaagc
ggtgacagatctctaagcagcagccagctggagtgcctgagcagaaaagggcaggagaag
accaaagggttccctggggcagacatgtcgggcagtctcaacaatcgcacaacaaaggat
gaccccaagggctcttccaagatgccagctggaagccccaccaaagcgaaggaggactgg
tgtgccaagtgccagctggtgcgaccagcccgggcatggcactgccggatatgtggcatc
tgtgtgaggagaatggatcatcattgtgtctggataaatagctgcgttggagaatcaaat
catcaagcatttatacttgcccttttgatcttcttgctcacctcggtgtatgggatcaca
ctgaccttggacaccatttgtagagacagaagtgtcttcacagctcttttctattgtcct
ggagtttatgcaaattacagctcggctctgtccttcacctgcgtgtggtactctgtgatc
atcacagcaggcatggcctacatcttcctgatccagctgatcaacatcagctacaatgtg
actgagcgggaagtccagcaggccctccgacagaagactgggcgccggctcctctgcggg
ctcatcgtggacacagggttacttggatga

DBGET integrated database retrieval system