KEGG   Homo sapiens (human): 2553Help
Entry
2553              CDS       T01001                                 

Gene name
GABPB1, BABPB2, E4TF1, E4TF1-47, E4TF1-53, E4TF1B, GABPB, GABPB-1, GABPB2, NRF2B1, NRF2B2
Definition
(RefSeq) GA binding protein transcription factor subunit beta 1
  KO
K09454  GA-binding protein transcription factor, beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2553 (GABPB1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    2553 (GABPB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    2553 (GABPB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    2553 (GABPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3 AAA_23
Motif
Other DBs
NCBI-GeneID: 2553
NCBI-ProteinID: NP_001307839
OMIM: 600610
HGNC: 4074
Ensembl: ENSG00000104064
Vega: OTTHUMG00000131642
Pharos: Q06547(Tbio)
UniProt: Q06547
Structure
PDB: 

Position
15q21.2
AA seq 395 aa AA seqDB search
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS
SETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANRE
AQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggtagatttgggaaagaagcttttagaagcggcacgagcaggtcaagatgat
gaagttcgtattttgatggcaaatggagctccctttactacagactggctgggaacttct
ccacttcatctagcagcacagtatggtcattattccaccacagaggtactgctgcgagct
ggtgtgagcagagatgccagaaccaaagtggaccgaacaccattacatatggcagcttct
gagggccatgccagcatagtagaggttttacttaagcatggtgctgatgtcaatgcaaag
gacatgttaaagatgacagctctccattgggccacagaacacaatcatcaagaggtggtg
gaacttttaatcaaatatggtgctgatgtacacacgcaaagtaaattttgtaaaactgca
tttgatatttcaatagacaatggaaatgaagatttagcagagatattacagattgctatg
cagaaccaaatcaacacaaacccagagagtcctgacactgtgacaatacatgctgcaaca
ccacagtttatcattggacctggaggggtggtgaacctaacaggtctggtatcttcagaa
aattcatccaaggcaacagatgaaacgggtgtatctgctgttcagtttggaaactcttct
acatcagtattagctacattagctgccttagctgaagcatctgctccattgtccaattct
tcagaaactccagtagtggccacagaagaagtagttactgcagaatctgtggatggtgcc
attcagcaagtagttagttcagggggtcagcaagtcatcacaatagttacagatggaatt
cagcttggaaatttgcactctattccaaccagtggaattggtcagcccatcattgtgacc
atgccagatggacaacaagtattaacagtaccagcaacagacattgctgaagaaactgtt
ataagtgaagaaccaccagctaagagacaatgtatcgaaataattgaaaaccgggtggaa
tctgcagaaatagaagagagagaagctcttcagaaacagctggatgaagcaaatcgagaa
gcacaaaaatatcgacagcagctcctaaagaaagaacaggaagcagaggcctacagacag
aagttggaagctatgactcgtcttcagactaataaagaagctgtttaa

DBGET integrated database retrieval system