KEGG   Homo sapiens (human): 257194
Entry
257194            CDS       T01001                                 
Symbol
NEGR1, DMML2433, IGLON4, KILON, Ntra
Name
(RefSeq) neuronal growth regulator 1
  KO
K06775  neuronal growth regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    257194 (NEGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    257194 (NEGR1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  IgLON family
   257194 (NEGR1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Ig_5 Izumo-Ig C2-set_2 Ig_4 V-set_CD47 Ig_C17orf99
Other DBs
NCBI-GeneID: 257194
NCBI-ProteinID: NP_776169
OMIM: 613173
HGNC: 17302
Ensembl: ENSG00000172260
UniProt: Q7Z3B1
Structure
Position
1:complement(71395943..72282539)
AA seq 354 aa
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRC
YLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
QTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAK
PFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRS
GLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAA
NKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggacatgatgctgttggtgcagggtgcttgttgctcgaaccagtggctggcggcggtg
ctcctcagcctgtgctgcctgctaccctcctgcctcccggctggacagagtgtggacttc
ccctgggcggccgtggacaacatgatggtcagaaaaggggacacggcggtgcttaggtgt
tatttggaagatggagcttcaaagggtgcctggctgaaccggtcaagtattatttttgcg
ggaggtgataagtggtcagtggatcctcgagtttcaatttcaacattgaataaaagggac
tacagcctccagatacagaatgtagatgtgacagatgatggcccatacacgtgttctgtt
cagactcaacatacacccagaacaatgcaggtgcatctaactgtgcaagttcctcctaag
atatatgacatctcaaatgatatgaccgtcaatgaaggaaccaacgtcactcttacttgt
ttggccactgggaaaccagagccttccatttcttggcgacacatctccccatcagcaaaa
ccatttgaaaatggacaatatttggacatttatggaattacaagggaccaggctggggaa
tatgaatgcagtgcggaaaatgatgtgtcattcccagatgtgaggaaagtaaaagttgtt
gtcaactttgctcctactattcaggaaattaaatctggcaccgtgacccccggacgcagt
ggcctgataagatgtgaaggtgcaggtgtgccgcctccagcctttgaatggtacaaagga
gagaagaagctcttcaatggccaacaaggaattattattcaaaattttagcacaagatcc
attctcactgttaccaacgtgacacaggagcacttcggcaattatacctgtgtggctgcc
aacaagctaggcacaaccaatgcgagcctgcctcttaaccctccaagtacagcccagtat
ggaattaccgggagcgctgatgttcttttctcctgctggtaccttgtgttgacactgtcc
tctttcaccagcatattctacctgaagaatgccattctacaataa

DBGET integrated database retrieval system