KEGG   Homo sapiens (human): 257629
Entry
257629            CDS       T01001                                 

Gene name
ANKS4B, HARP
Definition
(RefSeq) ankyrin repeat and sterile alpha motif domain containing 4B
  KO
K21414  ankyrin repeat and SAM domain-containing protein 4B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    257629 (ANKS4B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    257629 (ANKS4B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    257629 (ANKS4B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    257629 (ANKS4B)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 SAM_1 SAM_2 VSP
Other DBs
NCBI-GeneID: 257629
NCBI-ProteinID: NP_665872
OMIM: 609901
HGNC: 26795
Ensembl: ENSG00000175311
Vega: OTTHUMG00000177371
Pharos: Q8N8V4(Tdark)
UniProt: Q8N8V4
Position
16p12.2
AA seq 417 aa
MSTRYHQAASDSYLELLKEATKRDLNLSDEDGMTPTLLAAYHGNLEALEIICSRGGDPDR
CDIWGNTPLHFAASNGHAHCVSFLVNFGANIFALDNDLQTPLDAAASREQNECVALLDKA
ATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTF
SRSSPSNASAPGTFGSLSKGIKDTFKIKFKKNKDTAEQVGKEGRSGQRNVMEVFREEEED
SFSGDFKEKLQLSAEEDGSVHHESILNRPGLGSIVFRRNRISSPEDISDSKREFGFKLPS
ELLQRQGASEADEGAADEEGEENGLKDDLPWDDDEVEWEEDVVDATPLEVFLLSQHLEEF
LPIFKREQIDLEALLLCSDEDLQSIQMQLGPRKKVLNAINRRKQVLQQPGQLVDTSL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtctactcgttaccaccaagctgctagtgatagttacctggaacttctaaaagaggct
accaagcgagatctaaatctttcggatgaagacggcatgactcctactctcttggcagcc
taccatgggaacttggaagccctagagataatctgcagtagaggaggggaccctgatagg
tgtgacatctggggaaacactcctctacattttgcagcctccaatggccatgcccactgc
gtctcattcctggtcaactttggtgccaacatctttgccctggataatgacttacagact
ccactggatgctgctgccagcagggagcagaatgaatgtgttgctctcctggacaaggct
gccactgcacagaacatcatgaaccccaagaaggtcaccaggctgaaggagcaggctcag
aagaatgccaggaggcagatcaaagagtgtgagaggctccaggagaagcaccaaaataag
atggcccacacctacagcaaggaggaatccgggactctctcttcttccaagggtaccttc
tccagatcatccccttcaaatgcttctgctcctggcacattcgggtcactatctaagggc
attaaagacactttcaagatcaagttcaagaagaacaaagatacagcagaacaggtgggg
aaggaaggcagaagtgggcagaggaacgtgatggaagtgttcagagaggaagaggaagac
tcgttctcaggggacttcaaagagaagctccagttgtcagcagaggaggacggcagtgtg
caccatgaatccattctcaatcgtccaggtctaggaagtattgtttttagaaggaacagg
atatcgagtcctgaagacatctcagatagcaagagagagtttggttttaaactgcccagt
gaattgcttcaaagacaaggagcatcagaggctgatgagggtgcagctgatgaagaggga
gaggaaaacggcctcaaagatgatctgccgtgggatgacgatgaagtggagtgggaggaa
gatgtggtcgatgccacgcccctggaagtgttcttgctgtctcagcacctggaagaattc
ctgcctatcttcaagagagagcagattgatctagaagctctgctgctctgctctgatgag
gaccttcagagcatacaaatgcagctgggtcccaggaagaaagttctgaatgctatcaac
aggaggaagcaggtgcttcaacagcctgggcagctggtcgacaccagcctgtga

DBGET integrated database retrieval system