KEGG   Homo sapiens (human): 25804
Entry
25804             CDS       T01001                                 

Gene name
LSM4, GRP, YER112W
Definition
(RefSeq) LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12623  U6 snRNA-associated Sm-like protein LSm4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    25804 (LSM4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    25804 (LSM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    25804 (LSM4)
   03041 Spliceosome [BR:hsa03041]
    25804 (LSM4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     25804 (LSM4)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     25804 (LSM4)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    25804 (LSM4)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 25804
NCBI-ProteinID: NP_036453
OMIM: 607284
HGNC: 17259
Ensembl: ENSG00000130520
Vega: OTTHUMG00000183357
Pharos: Q9Y4Z0(Tbio)
UniProt: Q9Y4Z0
Structure
PDB: 
5O9Z 6AH0 3JCR

Position
19p13.11
AA seq 139 aa
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECY
IRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGI
PGTGRGQPEKKPGRQAGKQ
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcttcccttgtcactgctgaagacggctcagaatcaccccatgttggtggagctgaaa
aatggggagacgtacaatggacacctggtgagctgcgacaactggatgaacattaacctg
cgagaagtcatctgcacgtccagggacggggacaagttctggcggatgcccgagtgctac
atccgcggcagcaccatcaagtacctgcgcatccccgacgagatcatcgacatggtcaag
gaggaggtggtggccaagggccgcggccgcggaggcctgcagcagcagaagcagcagaaa
ggccgcggcatgggcggcgctggccgaggtgtgtttggtggccggggccgaggtgggatc
ccgggcacaggcagaggccagccagagaagaagcctggcagacaggcgggcaaacagtga

DBGET integrated database retrieval system