KEGG   Homo sapiens (human): 25894
Entry
25894             CDS       T01001                                 
Symbol
PLEKHG4, ARHGEF44, PRTPHN1, SCA4
Name
(RefSeq) pleckstrin homology and RhoGEF domain containing G4
  KO
K23860  pleckstrin homology domain-containing family G member 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    25894 (PLEKHG4)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   25894 (PLEKHG4)
SSDB
Motif
Pfam: RhoGEF PH PH_10 HET-s_218-289
Other DBs
NCBI-GeneID: 25894
NCBI-ProteinID: NP_001123199
OMIM: 609526
HGNC: 24501
Ensembl: ENSG00000196155
Vega: OTTHUMG00000172936
Pharos: Q58EX7(Tbio)
UniProt: Q58EX7 A0A024R6X4
Position
16:67277580..67289480
AA seq 1191 aa
MERPLENGDESPDSQGHATDWRFAVCSFRDAWEEEEPASQMHVKDPGPPRPPAGATQDEE
LQGSPLSRKFQLPPAADESGDAQRGTVESSSVLSEGPGPSGVESLLCPMSSHLSLAQGES
DTPGVGLVGDPGPSRAMPSGLSPGALDSDPVGLGDPLSEISKLLEAAPSGSGLPKPADCL
LAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQSECSSQELIRLLLYLRSIPR
PEVQALGLTVLVDARICAPSSSLFSGLSQLQEAAPGAVYQVLLVGSTLLKEVPSGLQLEQ
LPSQSLLTHIPTAGLPTSLGGGLPYCHQAWLDFRRRLEALLQNCQAACALLQGAIESVKA
VPQPMEPGEVGQLLQQTEVLMQQVLDSPWLAWLQCQGGRELTWLKQEVPEVTLSPDYRTA
MDKADELYDRVDGLLHQLTLQSNQRIQALELVQTLEARESGLHQIEVWLQQVGWPALEEA
GEPSLDMLLQAQGSFQELYQVAQEQVRQGEKFLQPLTGWEAAELDPPGARFLALRAQLTE
FSRALAQRCQRLADAERLFQLFREALTWAEEGQRVLAELEQERPGVVLQQLQLHWTRHPD
LPPAHFRKMWALATGLGSEAIRQECRWAWARCQDTWLALDQKLEASLKLPPVGSTASLCV
SQVPAAPAHPPLRKAYSFDRNLGQSLSEPACHCHHAATIAACRRPEAGGGALPQASPTVP
PPGSSDPRSLNRLQLVLAEMVATEREYVRALEYTMENYFPELDRPDVPQGLRGQRAHLFG
NLEKLRDFHCHFFLRELEACTRHPPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYGH
TFFKDKQQALGDHLDLASYLLKPIQRMGKYALLLQELARACGGPTQELSALREAQSLVHF
QLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFVVRTGRHKSVRRIFLFEELLLFSKPRH
GPTGVDTFAYKRSFKMADLGLTECCGNSNLRFEIWFRRRKARDTFVLQASSLAIKQAWTA
DISHLLWRQAVHNKEVRMAEMVSMGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRAS
IAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFPEEAALE
AEAELGGQPSLTAEDSEISSQCPSASGSSGSDSSCVSGQALGRGLEDLPCV
NT seq 3576 nt   +upstreamnt  +downstreamnt
atggaaaggcccctggagaatggggatgagtccccagactctcagggccatgccaccgac
tggagatttgctgtgtgcagtttcagggatgcctgggaagaggaggaacctgcttcccag
atgcacgttaaggacccaggtcctccaagaccaccagccggggccacccaggatgaggag
ctacagggcagccccttgtccaggaaattccagttacccccagctgcagatgagtcgggg
gatgcccagaggggcacagtagaaagctcctcagtcctgtcagaagggccaggcccctct
ggagtggagagtctcctatgccccatgtcctcccacctcagcttggcacagggtgagagt
gacaccccaggggtagggttggtaggggacccaggtccaagcagggcgatgccatctggc
ttgagccctggggcattggacagcgaccctgtgggccttggagaccctttatcagaaata
tcaaagctgctggaggcagcccccagtggatccggcctccctaagcctgctgactgcctc
ctggcccaagacctctgttgggagctgctggccagtggtatggccaccttgccagggact
cgggatgtccaaggccgggcagtgctgcttctgtgtgcccacagcccagcctggcttcag
tctgagtgcagcagccaggaactcatccgcctcctgctgtacctgcgaagcatccccagg
cccgaagtacaggcactgggactgacagtgctagttgatgcccgaatttgtgctccaagt
tcttccctcttctctgggctcagccaactacaagaagcagccccaggggccgtgtaccag
gtgctgctagtgggaagcacgctgctgaaggaagtgccttccgggctgcagctggagcag
ttgccttctcagagcctgctgacccacatcccaacggcggggctgcccacttcgctagga
ggaggcctgccttactgccaccaggcctggctggatttccgaaggcggctggaagctcta
ctacagaactgccaggcagcttgtgccctgctccagggggccatcgaaagtgtgaaggct
gtgccccagcccatggagcctggggaggtcggtcagctgctacagcagacagaggtcctg
atgcagcaggtgctagactcgccatggctggcatggctacaatgccaggggggccgggag
ctgacatggctgaagcaagaggtcccagaggtgaccctgagcccagactacaggacggca
atggacaaggctgacgagctatatgaccgggtggatggattgctgcaccaactgaccctg
cagagcaaccagcgaatacaggccctagagttggtccaaacactggaggcccgggaaagc
ggactgcaccagattgaagtgtggctgcagcaggtgggctggccagcactggaggaggct
ggggagccctcgctggacatgctgctccaggcccaaggctcttttcaggagctgtaccag
gttgcccaggagcaggtcaggcaaggggagaagtttctgcagccgctgactggctgggag
gcggctgaactggacccccctggggcacgctttctggccctgcgagcccagctgactgaa
ttctctagggctttggcccagcggtgccagcggctggcggatgctgagaggctgtttcag
ctcttcagggaggccttgacgtgggctgaggaggggcagcgagtgttggcagagctggag
caggaacgcccgggggttgtgttgcagcagctgcagctgcactggaccaggcaccctgac
ttgcctcctgcccacttccgaaagatgtgggctctggccacggggctgggctcagaggcc
atccgccaggagtgccgctgggcctgggcgcggtgccaggacacctggctggccctggac
caaaagcttgaggcttcactgaagctaccaccggtgggcagcacagctagcctgtgtgtc
agccaggtccccgctgcacctgcccaccctcccctgaggaaggcctacagcttcgatcgg
aatctggggcagagtctcagtgaacctgcctgccactgccaccatgcggccactattgct
gcctgccgcagaccagaggctggaggaggtgccctgccccaggcatcccctactgtgcct
ccaccaggcagctctgaccccaggagcctcaacaggctacagctggtgctggcagagatg
gtggccacggagcgggagtatgtccgggctctagagtacactatggagaactatttcccc
gagctggatcgccccgatgtgccccagggcctccgcggtcagcgtgcccacctctttggc
aacctggagaagctgcgggacttccactgccacttcttcctgcgtgagctggaggcttgc
acccggcacccaccacgagtggcctatgccttcctgcgccatagggtgcagtttgggatg
tacgcgctctacagcaagaataagcctcgctccgatgccctgatgtcaagctatgggcac
accttcttcaaggacaagcagcaagcactgggggaccacctggacctggcctcctacctg
ctaaagcccatccagcgcatgggcaagtacgcactgctgctgcaggagctggcacgggcc
tgcgggggccccacgcaggagctcagtgcgctgcgggaggcccagagccttgtgcacttc
cagctgcggcacggaaacgacctgctggccatggacgccatccagggctgtgatgttaac
ctcaaggaacaggggcagctggtgcgacaggatgagtttgtggtgcgcactgggcgccac
aagtccgtgcgccgcatcttcctttttgaggagctgctgctcttcagcaagcctcgccat
gggcccacaggggttgacacatttgcctacaagcgctccttcaagatggcagaccttggt
ctcactgagtgctgtgggaacagcaacctgcgcttcgagatctggttccgccgccgcaag
gccagggacacctttgtgctgcaggcctccagcctggctatcaagcaggcctggacagct
gacatctcccacctgctttggaggcaggccgtccacaacaaggaggtgcgcatggctgag
atggtgtccatgggtgtggggaacaaggccttccgagacattgctcccagcgaggaagcc
atcaacgaccgcaccgtcaactatgtcctgaagtgccgagaagttcgctctcgggcgtcc
attgccgtagccccgtttgaccatgacagcctctacctgggggcctcgaactcccttcct
ggagaccctgcctcttgctctgttctggggtccctcaacctgcacctgtacagagaccca
gctcttctgggtctccgctgtcccctgtatcccagcttcccagaggaagcagcactggag
gctgaggcagagctgggcggccagccctctttgactgctgaggactcagagatctcgtcc
caatgcccatcagccagtggctccagtggctctgacagcagctgtgtgtcagggcaggcc
ctgggtaggggcctggaggacttaccctgtgtctga

DBGET integrated database retrieval system