KEGG   Homo sapiens (human): 27063
Entry
27063             CDS       T01001                                 
Symbol
ANKRD1, ALRP, C-193, CARP, CVARP, MCARP, bA320F15.2
Name
(RefSeq) ankyrin repeat domain 1
  KO
K21433  ankyrin repeat domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01820  Sarcomere, Z-disc
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    27063 (ANKRD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27063 (ANKRD1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    27063 (ANKRD1)
SSDB
Motif
Pfam: Ank Ank_2 Ank_4 Ank_3 Ank_5
Other DBs
NCBI-GeneID: 27063
NCBI-ProteinID: NP_055206
OMIM: 609599
HGNC: 15819
Ensembl: ENSG00000148677
UniProt: Q15327 A0A384NYH5
Position
10:complement(90912096..90921087)
AA seq 319 aa
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQW
KSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVD
VPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIE
FRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
CEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTK
AIFDSLRENSYKTSRIATF
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatggtactgaaagtagaggaactggtcactggaaagaagaatggcaatggggaggca
ggggaattccttcctgaggatttcagagatggagagtatgaagctgctgttactttagag
aagcaggaggatctgaagacacttctagcccaccctgtgaccctgggggagcaacagtgg
aaaagcgagaaacaacgagaggcagagctcaaaaagaaaaaactagaacaaagatcaaag
cttgaaaatttagaagaccttgaaataatcattcaactgaagaaaaggaaaaaatacagg
aaaactaaagttccagttgtaaaggaaccagaacctgaaatcattacggaacctgtggat
gtgcctacgtttctgaaggctgctctggagaataaactgccagtagtagaaaaattcttg
tcagacaagaacaatccagatgtttgtgatgagtataaacggacagctcttcatagagca
tgcttggaaggacatttggcaattgtggagaagttaatggaagctggagcccagatcgaa
ttccgtgatatgcttgaatccacagccatccactgggcaagccgtggaggaaacctggat
gttttaaaattgttgctgaataaaggagcaaaaattagcgcccgagataagttgctcagc
acagcgctgcatgtggcggtgaggactggccactatgagtgcgcggagcatcttatcgcc
tgtgaggcagacctcaacgccaaagacagagaaggagataccccgttgcatgatgcggtg
agactgaaccgctataagatgatccgactcctgattatgtatggcgcggatctcaacatc
aagaactgtgctgggaagacgccgatggatctggtgctacactggcagaatggaaccaaa
gcaatattcgacagcctcagagagaactcctacaagacctctcgcatagctacattctga

DBGET integrated database retrieval system