KEGG   Homo sapiens (human): 27065
Entry
27065             CDS       T01001                                 
Symbol
NSG1, D4S234, D4S234E, NEEP21, P21
Name
(RefSeq) neuronal vesicle trafficking associated 1
  KO
K26676  neuronal vesicle trafficking-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27065 (NSG1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    27065 (NSG1)
SSDB
Motif
Pfam: Calcyon SID-1_RNA_chan DUF535 DUF2448
Other DBs
NCBI-GeneID: 27065
NCBI-ProteinID: NP_001035190
OMIM: 607645
HGNC: 18790
Ensembl: ENSG00000168824
UniProt: P42857 B2R5R8
Position
4:4386532..4419058
AA seq 185 aa
MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGK
ARPPQIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKN
TQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEA
AEKSA
NT seq 558 nt   +upstreamnt  +downstreamnt
atggtgaagttggggaacaatttcgcagagaagggcaccaagcagccgctgctggaggat
ggcttcgacaccattcccctgatgacgcccctcgatgtcaatcagctgcagttcccgccc
ccggataaggtggtcgtgaaaactaagaccgagtatgaacctgaccgcaagaaagggaaa
gcacgtcctccccaaattgctgagttcaccgtcagcatcacggagggtgtcaccgagagg
tttaaggtctccgtgttggtcctcttcgccctggccttcctcacctgcgtcgtcttcctg
gttgtctacaaggtgtacaagtatgaccgcgcctgccccgatgggttcgtcctcaagaac
acccagtgcatcccagaaggcttggagagctactacgcggagcaagactccagtgcccgg
gagaaattttacacagtcataaaccactacaacctggccaagcagagcatcacgcgctcc
gtatcgccctggatgtcagttctgtcagaagagaagctgtccgagcaggagactgaagcg
gctgagaagtcagcttag

DBGET integrated database retrieval system