KEGG   Homo sapiens (human): 27300
Entry
27300             CDS       T01001                                 
Symbol
ZNF544
Name
(RefSeq) zinc finger protein 544
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    27300 (ZNF544)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    27300 (ZNF544)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    27300 (ZNF544)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 zf_ZIC C1_4 zf-met zf-C2HE zf-C2H2_11
Other DBs
NCBI-GeneID: 27300
NCBI-ProteinID: NP_001307696
HGNC: 16759
Ensembl: ENSG00000198131
UniProt: Q6NX49
Position
19:58228914..58277455
AA seq 715 aa
MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHIVSLGLFLSKS
DVISQLEQEEDLCRAEQEAPRDWKATLEENRLNSEKDRAREELSHHVEVYRSGPEEPPSL
VLGKVQDQSNQLREHQENSLRFMVLTSERLFAQREHCELELGGGYSLPSTLSLLPTTLPT
STGFPKPNSQVKELKQNSAFINHEKNGADGKHCESHQCARAFCQSIYLSKLGNVETGKKN
PYEYIVSGDSLNYGSSLCFHGRTFSVKKSDDCKDYGNLFSHSVSLNEQKPVHFGKSQYEC
DECRETCSESLCLVQTERSGPGETPFRCEERCAAFPMASSFSDCNIIQTTEKPSVCNQCG
KSFSCCKLIHQRTHTGEKPFECTQCGKSFSQSYDLVIHQRTHTGEKPYECDLCGKSFTQR
SKLITHQRIHTGEKPYQCIECRKSFRWNSNLIVHQRIHTGEKPYECTHCGKSFSQSYELV
THKRTHTGEKPFKCTQCGKSFSQKYDLVVHQRTHTGEKPYECNLCGKSFSQSSKLITHQR
IHTGEKPYQCIECGKSFRWNSNLVIHQRIHTGEKPYDCTHCGKSFSQSYQLVAHKRTHTG
EKPYECNECGKAFNRSTQLIRHLQIHTGEKPYKCNQCNKAFARSSYLVMHQRTHTGEKPF
ECSQCGKAFSGSSNLLSHHRIHSGEKPYECSDCGKSFRQQSQLVVHRRTHTGEKP
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggaagcacgttctatgctggttccaccccaggcatctgtgtgcttcgaggatgtggct
atggcattcacacaggaggagtgggaacagctggacctggcccagaggacactgtaccga
gaggtgacactggagacctgggagcatattgtctccctggggcttttcctttccaaatct
gatgtgatctctcagctggagcaagaagaggacctgtgcagggcagagcaggaggccccc
cgagactggaaagctacccttgaggagaataggttgaattctgaaaaagatcgagctagg
gaagaactatcccaccacgtggaagtgtacaggagtggaccggaggagccaccctctttg
gtattaggaaaagtgcaagatcagagcaaccagttaagggaacaccaggagaactccttg
aggttcatggtactcacctcagagagactgtttgctcaaagggaacattgtgagcttgaa
cttgggggaggttattctctaccttctactttaagccttctacctacaacattacctaca
agtacaggtttccctaagcccaactcacaagttaaagagttgaaacaaaattcagctttc
attaatcatgagaaaaatggagcagatgggaagcactgtgagagtcatcagtgtgctaga
gctttctgtcagagtatttacttgagtaaacttggaaacgttgaaacaggaaagaaaaac
ccttatgaatatattgtcagtggtgactctctcaactatggttcctccctttgttttcat
ggtagaactttttcagtgaagaaaagtgatgactgtaaggattatggaaacctcttcagt
cacagtgtgtctctgaatgaacagaagccagtgcattttgggaaaagtcagtatgagtgt
gatgagtgcagggaaacctgttctgagagtctgtgccttgtacaaacagaaagaagtggc
cctggagagacccccttcagatgtgaggaacgctgtgctgccttccccatggcctcatct
ttttctgactgtaacatcattcagactacagagaagccatctgtgtgtaatcagtgtgga
aaatctttcagctgttgtaagctcatacaccagagaacacacactggagaaaagcccttc
gaatgtactcagtgtgggaaatcttttagccagagctatgaccttgtcatacatcagagg
acacacactggagagaagccctatgagtgtgacctgtgtgggaaatccttcacccagaga
tccaaacttattacacatcagcgaattcacactggagaaaaaccgtatcagtgtattgaa
tgcagaaaatccttcaggtggaactctaacctcattgtacatcagagaattcatactgga
gagaaaccgtatgagtgcactcactgtggaaagtccttcagccaaagctatgagttagtt
acacataaaagaacgcacactggagaaaaacccttcaaatgtactcagtgtgggaaatct
ttcagccagaagtatgaccttgttgtacatcagaggacacacactggagagaagccctat
gagtgcaacctgtgtgggaaatccttctcccagagttccaaacttattacgcatcagcga
attcacactggagaaaaaccgtatcagtgtattgaatgtgggaaatccttcagatggaac
tctaacctcgtcatacatcagagaattcatactggagagaaaccgtacgattgcactcac
tgtggaaagtccttcagccaaagctatcagttagttgcacataaaagaactcacactgga
gaaaagccctatgaatgtaacgagtgtggaaaagccttcaatcgaagcactcagctcatc
aggcatctgcaaattcacactggggagaagccgtacaaatgcaatcagtgcaataaagcc
tttgcaaggagctcctaccttgtgatgcatcagagaactcacactggtgagaaacctttt
gagtgtagtcagtgtgggaaagccttttcagggagctctaaccttctttcccatcacaga
attcattctggagagaaaccctatgaatgtagtgactgtgggaaatccttccggcagcaa
tctcaacttgtagtgcatcggcggacacatactggagagaaaccttag

DBGET integrated database retrieval system