KEGG   Homo sapiens (human): 2738
Entry
2738              CDS       T01001                                 

Gene name
GLI4, HKR4, ZNF928
Definition
(RefSeq) GLI family zinc finger 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zinc_ribbon_15 HypA zf-C2H2_jaz zf-trcl Zn_ribbon_SprT zf-H2C2_5 GAGA
Other DBs
NCBI-GeneID: 2738
NCBI-ProteinID: NP_612474
OMIM: 165280
HGNC: 4320
Ensembl: ENSG00000250571
Vega: OTTHUMG00000164952
Pharos: P10075(Tbio)
UniProt: P10075
Position
8q24.3
AA seq 376 aa
MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQ
DVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPE
SSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGA
KPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYE
CGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQC
GKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAF
GQSSQLIQHQRVHYRE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcagccctaggggacattcaggagtccccttctgtcccgtcccctgtcagtctctca
tcaccggggacacctggaacccagcaccacgagcctcagcttcacctccatgggcatcaa
catggctcccctggctccagccctaaggtgctctcccagccgtccgacctggatctccaa
gacgtagaggaagtggagatcggcagagacaccttctggcccgactccgagcccaagccg
gagcaggctccacgctctcctggctctcaggcccctgacgagggggcgggcggggcgctg
cgcagcctcctgaggagccttccccgcagggcccggtgcagcgccggcttcgggcctgaa
tccagcgcggagcggccggcgggccagccgcctggggccgtcccttgcgcccagccgcgg
ggcgcctggcgcgtgacgctcgtgcagcaagcagcggccgggcccgagggtgcgcccgag
cgggctgccgagctgggagtcaacttcggtcggagccggcagggcagcgcgcggggggcc
aagccgcacaggtgcgaggcctgcggcaagagtttcaagtataactcgctgctcctgaag
caccagcgcatccacacgggcgagaagccctacgcctgccacgagtgcggcaagcgcttc
cgcggctggtcgggcttcatccagcaccaccgcatccacacgggcgagaagccctacgag
tgcggccagtgcggccgcgccttcagccacagctcgcacttcacgcagcacctgcgcatc
cacaacggcgagaagccctacaagtgcggcgagtgcggccaggccttcagccagagctcc
aacctggtgcgccaccagcggctgcacacgggtgagaagccctacgcctgcagccagtgc
ggcaaggccttcatctggagctccgtgctcatcgagcaccagcgcatccacactggcgag
aagccctacgagtgctccgactgcggcaaagccttccgcggccgctcgcacttcttccgg
cacctgcggacccacacgggcgagaagcccttcgcgtgtggcgcctgcggcaaggccttc
ggccagagctcccagctcatccagcaccagcgggtgcactaccgcgagtag

DBGET integrated database retrieval system