KEGG   Homo sapiens (human): 28Help
Entry
28                CDS       T01001                                 

Gene name
ABO, A3GALNT, A3GALT1, GTB, NAGAT
Definition
(RefSeq) ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase
  KO
K00709  histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    28 (ABO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    28 (ABO)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     28 (ABO)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     28 (ABO)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  ABO blood group
   28 (ABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_6
Motif
Other DBs
NCBI-GeneID: 28
NCBI-ProteinID: NP_065202
OMIM: 110300
HGNC: 79
Ensembl: ENSG00000175164
Pharos: P16442(Tbio)
UniProt: P16442 A0A089QDC1
Structure
PDB: 

Position
9q34.2
AA seq 354 aa AA seqDB search
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggtgttgcggacgctggccggaaaaccaaaatgccacgcacttcgacctatg
atccttttcctaataatgcttgtcttggtcttgtttggttacggggtcctaagccccaga
agtctaatgccaggaagcctggaacgggggttctgcatggctgttagggaacctgaccat
ctgcagcgcgtctcgttgccaaggatggtctacccccagccaaaggtgctgacaccgtgt
aggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgggagggcacattc
aacatcgacatcctcaacgagcagttcaggctccagaacaccaccattgggttaactgtg
tttgccatcaagaaatacgtggctttcctgaagctgttcctggagacggcggagaagcac
ttcatggtgggccaccgtgtccactactatgtcttcaccgaccagccggccgcggtgccc
cgcgtgacgctggggaccggtcggcagctgtcagtgctggaggtgcgcgcctacaagcgc
tggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgcgagcggcgcttc
ctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttccgcgaccacgtg
ggcgtggagatcctgactccgctgttcggcaccctgcaccccggcttctacggaagcagc
cgggaggccttcacctacgagcgccggccccagtcccaggcctacatccccaaggacgag
ggcgatttctactacctgggggggttcttcggggggtcggtgcaagaggtgcagcggctc
accagggcctgccaccaggccatgatggtcgaccaggccaacggcatcgaggccgtgtgg
cacgacgagagccacctgaacaagtacctgctgcgccacaaacccaccaaggtgctctcc
cccgagtacttgtgggaccagcagctgctgggctggcccgccgtcctgaggaagctgagg
ttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system