KEGG   Homo sapiens (human): 283212
Entry
283212            CDS       T01001                                 
Symbol
KLHL35
Name
(RefSeq) kelch like family member 35
  KO
K10461  kelch-like protein 24/35
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    283212 (KLHL35)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     283212 (KLHL35)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_2 Kelch_4 Kelch_3 BTB Kelch_5 DUF4381 DUF5550
Other DBs
NCBI-GeneID: 283212
NCBI-ProteinID: NP_001034637
HGNC: 26597
Ensembl: ENSG00000149243
Pharos: Q6PF15(Tdark)
UniProt: Q6PF15
Position
11:complement(75422394..75433203)
AA seq 583 aa
MRQGHAPEESEPGCEAPCAGPCHAQRVLQALNAYRRSGTLTDVVLRAGGRDFPCHRAALS
AGSAYFRSLFAAGRPERGPAVVPVVPVAPEAPGTSPAGAAAALAVVLDYVYGAGVRLRAE
DEAAAVLALAERLGVAGLREACVRFLEGRLRAANSLALRRVAAAFSLAPLAERCGRVLRQ
AFAEVARHADFLELAPDEVVALLADPALGVAREEAVFEAAMRWVRHDAPARRGQLRRLLE
HVRLPLLAPAYFLEKVEADELLQACGECRPLLLEARACFILGREAGALRTRPRRFMDLAE
VIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTRSEFAACALRNDVYVSGGHIN
SHDVWMFSSHLHTWIKVASLHKGRWRHKMAVVQGQLFAVGGFDGLRRLHSVERYDPFSNT
WAAAAPLPEAVSSAAVASCAGKLFVIGGARQGGVNTDKVQCFDPKEDRWSLRSPAPFSQR
CLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRD
DRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgcggcaaggccatgcgccggaggagtcggagccgggctgcgaagcgccgtgcgcgggt
ccgtgccacgcgcagcgcgtgctgcaggccctgaacgcctaccggcggagcggcaccctc
accgacgtggtgctgcgcgccggcgggcgcgactttccgtgccaccgcgcggcgctcagc
gcgggcagcgcctacttccgcagcttgttcgcggccgggcggcccgagcgcggcccggcc
gtggtgccagtggtgccagtagctcccgaggcgccaggcacgagcccggccggggcggcg
gcggcgctggccgtggtgctcgactacgtgtacggagcgggcgtgcggctgcgcgcggag
gacgaggcggcggccgtgctggcgctggcggagcggctgggcgtggcgggcctgcgcgag
gcctgcgtgcgctttctcgagggccgcctgcgcgccgccaacagcctagcgctgcgccgc
gtggccgccgccttctcgctggccccgctggccgagcgctgcggccgcgtcctgcgtcag
gccttcgccgaggtggcgcgccacgccgacttcctggagctggcgcctgacgaggtggtg
gcgctgctggcggaccccgcgctgggcgtggcgcgcgaggaggccgtgtttgaagcggcc
atgcgctgggtgcgccacgacgcgccggcccgccgcggccagctgcgacgcctgctggag
cacgtgcgcctgccgctactggcgcccgcttacttcctggagaaggtggaggcggacgag
ctgctgcaggcctgcggcgagtgccgcccgctgctgctcgaggctcgcgcctgcttcatc
ctgggccgcgaggccggtgcgctgcggacccggccgcggagattcatggacctagctgaa
gtgatcgtggtcatcggcggttgcgaccgcaaaggtctcctgaagctgcccttcgccgat
gcctaccatccagagagccagcggtggaccccactgcccagcctgcccggctacactcgc
tcagaattcgccgcctgtgctctccgcaatgacgtctacgtctccggaggccacatcaac
agtcatgatgtgtggatgtttagctcccatctgcacacctggatcaaggtagcctctctg
cacaagggcaggtggaggcacaagatggcagttgtgcaggggcagctgttcgcggtgggt
ggcttcgacggcctgaggcgcctgcacagcgtggagcgctacgaccccttctccaacacc
tgggcggccgccgcgcccctcccggaggccgtgagctcggcggcggtggcgtcctgcgcg
ggcaagctcttcgtgattgggggcgccaggcagggcggcgtcaacacggacaaggtgcag
tgctttgaccccaaggaggaccggtggagcctgcggtcaccagcacccttctcacagcgg
tgtctcgaggctgtctcccttgaggacaccatctatgtcatggggggtctcatgagcaaa
atcttcacctatgatccaggcacagatgtgtggggggaggcagctgtcctccccagccct
gtggaaagctgtggagtcactgtgtgtgacgggaaggtccacatccttggcgggcgggat
gatcgcggagaaagcaccgataaggtcttcacctttgaccccagcagtgggcaggtggag
gtccagccatccctgcagcgctgcaccagctcccacggctgtgtcaccatcatccagagc
ttgggcaggtga

DBGET integrated database retrieval system