KEGG   Homo sapiens (human): 283383
Entry
283383            CDS       T01001                                 

Gene name
ADGRD1, GPR133, PGR25
Definition
(RefSeq) adhesion G protein-coupled receptor D1
  KO
K08465  adhesion G-protein coupled receptor D1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    283383 (ADGRD1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    283383 (ADGRD1)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   283383 (ADGRD1)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Others
   283383 (ADGRD1)
SSDB
Motif
Pfam: 7tm_2 Laminin_G_3 GPS Dicty_CAR Pentaxin
Other DBs
NCBI-GeneID: 283383
NCBI-ProteinID: NP_942122
OMIM: 613639
HGNC: 19893
Ensembl: ENSG00000111452
Vega: OTTHUMG00000168339
Pharos: Q6QNK2(Tbio)
UniProt: Q6QNK2 Q9NSM3
Position
12q24.33
AA seq 874 aa
MEKLLRLCCWYSWLLLFYYNFQVRGVYSRSQDHPGFQVLASASHYWPLENVDGIHELQDT
TGDIVEGKVNKGIYLKEEKGVTLLYYGRYNSSCISKPEQCGPEGVTFSFFWKTQGEQSRP
IPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGL
KVYVNGTLSTSDPSGKVSRDYGESNVNLVIGSEQDQAKCYENGAFDEFIIWERALTPDEI
AMYFTAAIGKHALLSSTLPSLFMTSTASPVMPTDAYHPIITNLTEERKTFQSPGVILSYL
QNVSLSLPSKSLSEQTALNLTKTFLKAVGEILLLPGWIALSEDSAVVLSLIDTIDTVMGH
VSSNLHGSTPQVTVEGSSAMAEFSVAKILPKTVNSSHYRFPAHGQSFIQIPHEAFHRHAW
STVVGLLYHSMHYYLNNIWPAHTKIAEAMHHQDCLLFATSHLISLEVSPPPTLSQNLSGS
PLITVHLKHRLTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCALTRGNLTYSVCR
CTHLTNFAILMQVVPLELARGHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQ
RYHIHANLSFAVLVAQVLLLISFRLEPGTTPCQVMAVLLHYFFLSAFAWMLVEGLHLYSM
VIKVFGSEDSKHRYYYGMGWGFPLLICIISLSFAMDSYGTSNNCWLSLASGAIWAFVAPA
LFVIVVNIGILIAVTRVISQISADNYKIHGDPSAFKLTAKAVAVLLPILGTSWVFGVLAV
NGCAVVFQYMFATLNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFH
SDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
NT seq 2625 nt   +upstreamnt  +downstreamnt
atggaaaagctgctgcggctgtgctgctggtactcctggctgctgctattttattacaac
tttcaggtgcgtggcgtctactccagatcgcaggaccatccaggatttcaggtgttggcg
tctgcttcccattactggccactggagaatgtggatgggatccatgaacttcaggataca
actggagatattgtggaagggaaggtcaacaaaggcatttacctgaaagaggaaaaggga
gtcacgcttctctattacggcaggtacaacagctcctgcatcagcaagccagagcagtgt
ggccctgaaggggtcacgttttcttttttctggaagacacaaggagaacagtctagacca
atcccttctgcgtatgggggacaggtcatctccaatgggttcaaagtctgctccagcggt
ggcagaggctctgtggagctgtatacgcgggacaattccatgacatgggaggcctccttc
agccccccaggcccctattggactcatgtcctatttacatggaaatccaaggagggcctg
aaagtctacgtcaacgggaccctgagcacctctgatccgagtggaaaagtgtctcgtgac
tatggagagtccaacgtcaacctcgtgatagggtctgagcaggaccaggccaagtgttat
gagaacggtgctttcgatgagttcatcatctgggagcgggctctgactccggatgagatc
gccatgtacttcactgctgccattggaaagcatgctttattgtcttcaacgctgccaagc
ctcttcatgacatccacagcaagccccgtgatgcccacagatgcctaccatcccatcata
accaacctgacagaagagagaaaaaccttccaaagtcccggagtgatactgagttacctc
caaaatgtatccctcagcttacccagtaagtccctctcggagcagacagccttgaatctc
accaagaccttcttaaaagccgtgggagagatccttctactgcctggttggattgctctg
tcagaggacagcgccgtggtactgagtctcatcgacactattgacaccgtcatgggccat
gtatcctccaacctgcacggcagcacgccccaggtcaccgtggagggctcctctgccatg
gcagagttttccgtggccaaaatcctgcccaagaccgtgaattcctcccattaccgcttc
ccggcccacgggcagagcttcatccagatcccccacgaggccttccacaggcacgcctgg
agcaccgtcgtgggtctgctgtaccacagcatgcactactacctgaacaacatctggccc
gcccacaccaagatcgcggaggccatgcatcaccaggactgcctgctgttcgccaccagc
cacctgatttccctggaggtgtccccaccacccaccctgtctcagaacctgtcgggctct
ccactcattacggtccacctcaagcacagattgacacgtaagcagcacagtgaggccacc
aacagcagcaaccgagtcttcgtgtactgcgccttcctggacttcagctccggagaaggg
gtctggtcgaaccacggctgtgcgctcacgagaggaaacctcacctactccgtctgccgc
tgcactcacctcaccaactttgccatcctcatgcaggtggtcccgctggagcttgcacgc
ggacaccaggtggcgctgtcgtctatcagctatgtgggctgctccctctccgtgctctgc
ctggtggccacgctggtcaccttcgccgtgctgtcctccgtgagcaccatccggaaccag
cgctaccacatccacgccaacctgtccttcgccgtgctggtggcccaggtcctgctgctc
attagtttccgcctcgagccgggcacgaccccctgccaagtgatggccgtgctcctacac
tacttcttcctgagtgccttcgcatggatgctggtggaggggctgcacctctacagcatg
gtgatcaaggtctttgggtcggaggacagcaagcaccgttactactatgggatgggatgg
ggttttcctcttctgatctgcatcatttcactgtcatttgccatggacagttacggaaca
agcaacaattgctggctgtcgttggcgagtggcgccatctgggcctttgtagcccctgcc
ctgtttgtcatcgtggtcaacattggcatcctcatcgctgtgaccagagtcatctcacag
atcagcgccgacaactacaagatccatggagaccccagtgccttcaagttgacagccaag
gcagtggccgtgctgctgcccatcctgggtacctcgtgggtctttggcgtgcttgctgtc
aacggttgtgctgtggttttccagtacatgtttgccacgctcaactccctgcagggactg
ttcatattcctctttcattgtctcctgaattcagaggtgagagccgccttcaagcacaaa
accaaggtctggtcgctcacgagcagctctgcccgcacctccaacgcgaagcccttccac
tcggacctcatgaatgggacccggccaggcatggcctccaccaagctcagcccttgggac
aagagcagccactctgcccaccgcgtcgacctgtcagccgtgtga

DBGET integrated database retrieval system