KEGG   Homo sapiens (human): 284306
Entry
284306            CDS       T01001                                 

Gene name
ZNF547, MIP-2A, SEDLP1, TRAPPC2.19, TRAPPC2B, TRAPPC2P1
Definition
(RefSeq) zinc finger protein 547
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    284306 (ZNF547)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    284306 (ZNF547)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    284306 (ZNF547)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf_UBZ zf-C2H2_6 zinc_ribbon_15 XAF1_C UPF0547 Zn-ribbon_8
Other DBs
NCBI-GeneID: 284306
NCBI-ProteinID: NP_775902
HGNC: 26432
Ensembl: ENSG00000152433
Vega: OTTHUMG00000183246
Pharos: Q8IVP9(Tdark)
UniProt: Q8IVP9
Position
19q13.43
AA seq 402 aa
MAEMNPAQGHVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGCCHGAEDEE
APLEPGVSVGVSQVMAPKPCLSTQNTQPCETCSSLLKDILRLAEHDGTHPEQGLYTCPAH
LHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTFLCSECGKAFSHKHKLSDHQKIHTG
ERTYKCSKCGILFMERSTLNRHQRTHTGERPYECNECGKAFLCKSHLVRHQTIHSGERPY
ECSECGKLFMWSSTLITHQRVHTGKRPYGCSECGKFFKCNSNLFRHYRIHTGKRSYGCSE
CGKFFMERSTLSRHQRVHTGERPYECNECGKFFSLKSVLIQHQRVHTGERPYECSECGKA
FLTKSHLICHQTVHTAAKQCSECGKFFRYNSTLLRHQKVHTG
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcagaaatgaaccctgcacagggtcatgtggtttttgaagacgtggccatatatttc
tcccaggaggagtgggggcatctcgatgaggctcagagattgctgtaccgtgatgtgatg
ctggagaatttggcccttttgtcctcactaggttgttgccatggagctgaggatgaggag
gcacctttagagccaggtgtttctgtaggagtgtcacaggtcatggctccaaagccctgt
ctatctacccagaatacccagccctgtgagacatgtagctcacttctgaaggacattctg
cgtctggctgagcatgacggaacacaccccgagcagggactgtacacgtgtccagcacat
cttcaccagcaccaaaaggagcagattagagagaaactttctagaggggatggaggaaga
ccgacatttgtgaagaaccacagagttcacatggcagggaagaccttcttgtgcagtgaa
tgtgggaaagcctttagccacaaacataaactttctgaccatcagaaaatccacactgga
gaaagaacttataagtgcagcaaatgtgggatattgtttatggaaaggtccacactcaat
agacatcagagaactcacactggagaaaggccttatgagtgcaatgaatgtgggaaagcc
tttctttgtaagtctcaccttgttcgtcaccagacaatccactctggagaaaggccttat
gagtgcagtgaatgtgggaaattgtttatgtggagttccacactcattacacatcagagg
gttcacactggaaagaggccttatggttgcagtgaatgtgggaagttctttaagtgcaac
tcaaacctctttaggcattacagaattcatacaggaaaaaggtcttatggttgcagtgaa
tgtgggaaattctttatggaaaggtctacactcagtagacatcagagagttcacactgga
gaaaggccttatgagtgcaatgaatgtgggaaattcttcagcttgaaatccgtcctcatt
caacaccaaagagttcacactggagaacggccttatgaatgcagtgagtgtgggaaggcc
ttccttacaaagtcccacctcatttgtcatcagacagttcacactgcagcaaagcagtgc
agtgaatgtgggaaattctttaggtataactctacacttctcagacatcagaaagtccac
actggataa

DBGET integrated database retrieval system