KEGG   Homo sapiens (human): 284309
Entry
284309            CDS       T01001                                 

Gene name
ZNF776
Definition
(RefSeq) zinc finger protein 776
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_11 zf-C2H2_jaz C1_1 zf-met zf-C2H2_6
Other DBs
NCBI-GeneID: 284309
NCBI-ProteinID: NP_775903
HGNC: 26765
Ensembl: ENSG00000152443
Vega: OTTHUMG00000156943
Pharos: Q68DI1(Tdark)
UniProt: Q68DI1 B2RN90 B4DSC6
Position
19q13.43
AA seq 518 aa
MAAAALRPPAQGTVTFEDVAVNFSQEEWSLLSEAQRCLYHDVMLENLTLISSLGCWYGAK
DETPSKQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYE
KKLDDDANHHQDQKQHIGEKSYRSNAKGTSFVKNCKFHMSHEPFIFHEVGKDFLSSLRLL
QQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSD
SGKFTSKSNSFNNHQGVRTGKRPYQCGQCDESFWYKAHLTEHQRVHTGERPYECGECDKS
FSHKHSLVDHQRVHTGERPYECDECGKSFSHKRSLVHHQRVHTGERPYQCGECGKSFNHK
CNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTGERPYECKECRKSFRYKSHLT
EHQRVHTGERPYECRECGKCFHQKGSLIQHQQIHSGERPHECGECGKCFHQKGSLIRHQQ
IHSGERPHECGECGKCFRQKGNLIKHQRVHTGERHHEC
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcggcggccgcgctgaggcccccggctcagggcactgtgacctttgaagatgtggct
gtgaacttttcccaggaggaatggagtctccttagtgaggctcagagatgcctttatcat
gacgtgatgctggagaacctgacacttatatcttctctaggttgttggtatggagcaaaa
gacgagacaccttctaagcagaccctttctatacaacaggagtccccactcaggacacat
tggacaggtgtatgtaccaagaaggtccacctctggggaatgtgtggccctctcctggga
gatatcttacaccagggaacacaacacaatcagaaattgaatgggtttggggcatatgaa
aaaaaattggatgacgatgcaaaccatcatcaagaccagaagcagcacattggagagaaa
tcgtacagaagcaatgccaagggaacatcttttgtaaagaactgtaaattccatatgtca
catgagccatttatctttcatgaggttgggaaagactttttgtccagcttgagattactc
caacaagaggacattcacacttcagggaagtcaaactttgaaactaagcatgggataccc
cttcagggtggaaaaactcattacatctgtggagagtccacaataccgtttagcaacaaa
cactcacttgtccttcaccagagacttctccctagagaaggaccttatgtatgcagtgat
tctgggaaattcactagcaaaagtaatagttttaataatcatcagggagttcgcactgga
aaaagaccttatcagtgtggacaatgtgatgaatcattttggtataaggcccacctcact
gaacaccagagagttcacactggagaaagaccttatgagtgtggagaatgtgataaatct
tttagtcataagcacagtcttgttgaccatcagcgagttcacactggagaaagaccttat
gaatgtgacgaatgtgggaaatcttttagccataagcgcagccttgttcaccaccagcga
gttcacactggagaaagaccttatcagtgtggagaatgtgggaaatcgtttaatcacaag
tgcaacctcattcagcatcagcgagttcacactggagaaagaccttttgagtgtacggca
tgtgggaagttatttaggagcaactcccacctaaaggaacaccagagagttcacactgga
gaaagaccctatgagtgtaaagaatgtaggaaatcatttaggtacaagtcacacctcact
gaacaccagagagttcacactggagaaaggccatatgagtgtagagaatgtgggaaatgt
tttcatcaaaagggcagtctcattcaacatcagcagatccactctggagaaaggccacat
gagtgtggagaatgtgggaaatgttttcatcaaaagggcagtctcattcgacatcagcag
attcactctggagaaaggccacatgagtgtggagaatgtggaaagtgttttcgtcaaaag
ggaaacctcattaaacatcaacgagttcacacgggagaaagacatcatgaatgttga

DBGET integrated database retrieval system