KEGG   Homo sapiens (human): 284403
Entry
284403            CDS       T01001                                 

Gene name
WDR62, C19orf14, MCPH2
Definition
(RefSeq) WD repeat domain 62
  KO
K21762  WD repeat-containing protein 62
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    284403 (WDR62)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    284403 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 284403
NCBI-ProteinID: NP_775907
OMIM: 613583
HGNC: 24502
Ensembl: ENSG00000075702
Vega: OTTHUMG00000048139
Pharos: O43379(Tbio)
UniProt: O43379
Position
19q13.12
AA seq 1518 aa
MAAVGSGGYARNDAGEKLPSVMAGVPARRGQSSPPPAPPICLRRRTRLSTASEETVQNRV
SLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINRVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQGSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITS
MKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHTNDKKRSGHPRQD
TYVSTPSEIHSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRL
LGDDDVADGLAFHAKRSYQPHGRWAERAGQEPLKTILDAQDLDCYFTPMKPESLENSILD
SLEPQSLASLLSESESPQEAGRGHPSFLPQQKESSEASELILYSLEAEVTVTGTDSQYCR
KEVEAGPGDQQGDSYLRVSSDSPKDQSPPEDSGESEADLECSFAAIHSPAPPPDPAPRFA
TSLPHFPGCAGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRALGDVEA
SEAEDHFFNPRLSISTQFLSSLQKASRFTHTFPPRATQCLVKSPEVKLMDRGGSQPRAGT
GYASPDRTHVLAAGKAEETLEAWRPPPPCLTSLASCVPASSVLPTDRNLPTPTSAPTPGL
AQGVHAPSTCSYMEATASSRARISRSISLGDSEGPIVATLAQPLRRPSSVGELASLGQEL
QAITTATTPSLDSEGQEPALRSWGNHEARANLRLTLSSACDGLLQPPVDTQPGVTVPAVS
FPAPSPVEESALRLHGSAFRPSLPAPESPGLPAHPSNPQLPEARPGIPGGTASLLEPTSG
ALGLLQGSPARWSEPWVPVEALPPSPLELSRVGNILHRLQTTFQEALDLYRVLVSSGQVD
TGQQQARTELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPSPPTLYPLASPDLQALL
EHYSELLVQAVRRKARGH
NT seq 4557 nt   +upstreamnt  +downstreamnt
atggcggccgtagggtccggaggctatgcgcggaacgatgcaggggagaagctgccctct
gtcatggcgggagttccggcgcggaggggccagtcctccccgccccccgccccaccaatc
tgcctacggcggcggacgcgactctcgacggcctccgaggagacggtgcagaaccgggtg
tcactcgagaaggtgcttggcatcacagcccagaacagcagtggcctaacctgtgacccc
ggcacaggccatgtggcctacctggcaggctgtgtggtggtgattttggaccccaaggag
aacaagcagcagcacatctttaacaccgccaggaagtctctcagtgctctggccttctcc
cctgatgggaagtacatagtgacaggggagaatgggcataggcctgctgtgcgcatctgg
gatgtggaggagaagaatcaggtggcggagatgctaggccacaagtatggtgtggcgtgt
gtggccttctcacccaatatgaagcacatcgtgtccatgggctaccaacatgacatggtg
ctcaacgtctgggactggaagaaagacatcgtagtggcctccaacaaggtatcttgtaga
gtcattgccctctccttctcagaggacagcagctattttgtcactgttgggaaccgccat
gtgaggttctggttcttggaagtctccactgagacaaaggtgacgagcacagtgcccctt
gtagggcgctcgggcatcctgggcgagctgcacaacaacatcttctgtggtgtggcctgc
ggtcggggccggatggcgggcagtaccttctgtgtgtcctactcgggcctcctctgccag
ttcaatgagaagagggtgctggagaagtggatcaacctgaaggtctccctgtcttcctgc
ctctgtgtcagccaggagctcatcttctgtggctgcacagatgggatagtccgcatcttc
caggcccatagcctgcactacctcgccaacctgcccaagccacactaccttggggtagac
gtggcacagggcctggagcccagcttcctcttccacaggaaggcggaagcagtctaccca
gatacagtggcactgaccttcgaccccatccaccagtggctgtcctgcgtgtataaggac
cacagcatctacatctgggatgtcaaggacatcaacagagtgggcaaggtgtggtcagag
ctcttccacagctcctacgtttggaacgtggaggtgtatcctgagtttgaagaccagaga
gcttgtttgccatcaggatcctttctgacttgttcttcagacaacaccattcgcttctgg
aacttggacagcagccctgattctcactggcagaaaaacatcttcagcaataccctgctg
aaggtcgtgtacgtggagaatgacatccagcacctgcaggacatgtcacacttcccagac
cgggggagcgagaatgggacacccatggacgtgaaagccggggtgcgggtcatgcaggtc
agtcctgacggccagcatttggcttcaggcgaccgaagtggaaatctgaggatccacgag
ctgcacttcatggacgagctggtcaaggtggaggcccatgatgctgaggtgctgtgcctg
gagtactccaagccagagacggggctgaccttgctggcctcagccagtcgggaccggctg
atccatgtgctgaacgtggagaagaactacaacctggagcagacgctggatgaccactcc
tcctccatcaccgccatcaagttcgctggcaacagagacatccagatgatcagctgtggg
gctgacaagagcatctactttcgcagtgcccagcagggttcggatggactacactttgtc
cgtacccaccacgtagcagagaaaaccaccttgtatgacatggacattgacatcacccag
aagtacgtggccgtggcctgccaggaccgcaatgtgagagtctacaacactgtgaacggg
aagcagaagaagtgctacaagggctcccagggtgacgaagggtccttgctgaaggtccat
gtggacccctcaggcaccttcctggccaccagctgctctgacaaaagcatctcagtgatt
gacttttactcgggcgagtgcattgccaagatgtttggccattcagaaattattaccagc
atgaagttcacctatgactgtcatcacttgatcacagtatctggagacagctgcgtgttc
atctggcacctgggcccggagatcaccaactgcatgaagcagcacttgctggagattgac
caccggcagcagcagcagcacacaaatgacaagaagcggagtggccaccccaggcaggat
acgtatgtgtccacacctagtgagattcactccctgagccctggagagcaaacagaggat
gatctggaggaagagtgtgagccagaagagatgctgaagacaccatccaaagatagcttg
gatccagatcctcgttgcctgctaaccaacggcaagctgccactgtgggcaaagcggctg
ctaggggacgatgatgtggcagatggcttggccttccacgccaagcgcagctaccagccc
cacggccgctgggcagagcgggccggccaagagcccctcaagaccatcctggatgcccag
gacctggattgctactttacccccatgaagcccgagagtctggagaactccattctggat
tcactggagccacagagcctggccagcctgctgagtgagtcagagagtccccaggaagct
ggccgcgggcacccctccttcctgccccagcagaaggaatcatctgaggccagtgagctc
atcctctactctctggaggcagaagtgacagtcacagggacagacagccagtattgcagg
aaggaggtggaggccgggcctggagaccagcagggcgactcctacctcagggtgtcctcc
gacagcccaaaggaccagagcccgcctgaggactcgggggagtcagaggccgacctggag
tgcagcttcgcagccatccactccccagctccgcctcctgaccctgcccctcggtttgcc
acgtcgctgccccatttcccaggatgcgcaggtcccacagaagatgagctgtccctgccc
gagggacccagcgtccccagcagctccctaccccagactccggagcaggagaagttcctc
cgccaccactttgagacactgactgagtccccctgcagagctctgggagacgtggaggcc
tctgaagctgaagaccacttcttcaacccacgcctgagtatctccacgcagttcctctca
agcctccagaaggcatccaggttcacccataccttccctccccgggcaacccagtgcctt
gtgaagtctccagaggtcaagctcatggaccgaggcggaagccagcccagagcaggtact
ggctacgcctccccagacaggacccacgtcctcgctgcagggaaggctgaagagaccctg
gaggcctggcgcccaccacctccctgccttacgagcctggcgtcctgtgtccctgcttcc
tccgtgctgcccacagacaggaatctcccaacgcccacatctgcacccaccccaggcctg
gctcagggtgtccatgccccctccacctgttcctacatggaggccactgccagctcccgt
gccaggatatcacgcagcatctccctcggtgacagtgagggccctatcgtggccacactg
gcccagcccctccgtaggccatcgtccgttggggagctggcctccttgggccaggagctt
caggccatcaccaccgcgacaacacccagtttggacagtgagggccaagagcctgccctg
cgttcctggggcaaccacgaggcccgggccaacctgagactgaccctgtcaagtgcctgt
gatgggctcctgcagccccccgtggatacccagcctggcgtcaccgtccctgcagtgagc
ttcccagcccctagccctgtggaagagagcgccctgaggctccacggctctgcctttcgc
ccaagtctcccagctcctgagtcccctggccttcctgcccaccccagtaacccccagctt
ccagaggcccggcctggcatccctggcggcactgcctccctcctggagcccacctccggt
gcacttggtctgttacagggcagccctgcccgctggagtgagccctgggtgccggttgaa
gccctgcccccatctccccttgagctgagcagggtggggaacatcttgcacaggctgcag
accaccttccaagaagccctcgacctttaccgtgtgttggtctccagtggccaggtggac
accgggcagcagcaggcacggactgagctggtctccaccttcctgtggatccacagccag
ctggaggctgaatgcctggtggggactagtgtggccccagcccaggctctgcccagccca
ggacccccgtccccaccgacgctgtaccccctggccagcccagacctgcaggccctgctg
gaacactactcggagctgctggtgcaggccgtgcggaggaaggcacgggggcactga

DBGET integrated database retrieval system