KEGG   Homo sapiens (human): 285989
Entry
285989            CDS       T01001                                 
Symbol
ZNF789
Name
(RefSeq) zinc finger protein 789
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 zf-C2H2_8 Zn-ribbon_8 PknG_rubred
Other DBs
NCBI-GeneID: 285989
NCBI-ProteinID: NP_998768
HGNC: 27801
Ensembl: ENSG00000198556
UniProt: Q5FWF6
Position
7:99472890..99487605
AA seq 425 aa
MFPPARGKELLSFEDVAMYFTREEWGHLNWGQKDLYRDVMLENYRNMVLLGFQFPKPEMI
CQLENWDEQWILDLPRTGNRKASGSACPGSEARHKMKKLTPKQKFSEDLESYKISVVMQE
SAEKLSEKLHKCKEFVDSCRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGK
PFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHFLENPFECKVCGQAFRQ
RSALTVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHTKEKPYKCSKCEKTFSQNSTL
IRHQVIHSGEKRHKCLECGKAFGRHSTLLCHQQIHSKPNTHKCSECGQSFGRNVDLIQHQ
RIHTKEEFFQCGECGKTFSFKRNLFRHQVIHTGSQPYQCVICGKSFKWHTSFIKHQGTHK
GQIST
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgttcccaccagccagggggaaggagctgctctcgtttgaggatgtggcgatgtacttc
accagagaggagtggggccacctcaactggggtcagaaggacctctaccgagatgtgatg
ttggagaactacaggaacatggtcttgctgggatttcagtttcccaaacctgagatgatc
tgtcagctggagaactgggacgagcagtggatcctggatctaccgagaactgggaatagg
aaggcttccggtagtgcttgcccaggttctgaagccagacacaagatgaaaaagctaact
ccaaaacagaaattttctgaagatttagagtcatataagatatcagtggtaatgcaggaa
tcagctgagaaactttcagaaaagttacataagtgtaaagaatttgtggacagttgcagg
cttactttccctactagtggtgatgaatacagcaggggcttccttcaaaaccttaacctt
attcaagatcagaatgcgcaaacaaggtggaagcagggcagatatgatgaggatggcaaa
cccttcaatcaaagatctttgcttttggggcatgagcgaattctcacaagagcaaagtct
tatgaatgcagtgaatgtggaaaagtcattaggcgtaaggcatggtttgatcaacatcaa
agaattcactttttagagaatccttttgagtgtaaggtctgtgggcaagccttcagacag
cggtcagctcttacggtccataaacagtgtcacctgcaaaacaagccatacagatgtcat
gactgtggaaagtgttttcggcagctcgcgtatcttgttgaacataagaggattcacacc
aaagaaaaaccttataaatgtagcaaatgtgaaaaaacgtttagtcagaattcaaccctt
attcgacatcaggtgatccatagtggagaaaaacgccataaatgccttgagtgtggaaaa
gcctttggccggcattcaacccttctatgtcatcaacagattcacagtaaaccgaacacc
cataaatgcagtgaatgtggacagtcctttggtaggaatgtggatctcattcagcatcaa
agaatccatacaaaggaggaattctttcaatgtggagaatgtgggaaaacgtttagtttt
aagaggaatctttttcgacatcaggtcattcacactggaagccaaccctaccaatgtgtc
atatgtggaaaatctttcaagtggcacacaagctttattaagcaccagggcactcacaaa
ggacagatatccacatga

DBGET integrated database retrieval system