KEGG   Homo sapiens (human): 2892Help
Entry
2892              CDS       T01001                                 

Gene name
GRIA3, GLUR-C, GLUR-K3, GLUR3, GLURC, GluA3, MRX94
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 3
  KO
K05199  glutamate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05202  Transcriptional misregulation in cancer
Network
N00120  MLL-ENL fusion to transcriptional activation
Disease
H00658  Syndromic X-linked mental retardation
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2892 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2892 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2892 (GRIA3)
   04728 Dopaminergic synapse
    2892 (GRIA3)
   04730 Long-term depression
    2892 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    2892 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2892 (GRIA3)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    2892 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    2892 (GRIA3)
   05033 Nicotine addiction
    2892 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2892 (GRIA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2892 (GRIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061 NusG_add
Motif
Other DBs
NCBI-GeneID: 2892
NCBI-ProteinID: NP_000819
OMIM: 305915
HGNC: 4573
Ensembl: ENSG00000125675
Vega: OTTHUMG00000022685
Pharos: P42263(Tclin)
UniProt: P42263 Q17R51
Position
Xq25
AA seq 894 aa AA seqDB search
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaagcgtgctccgggcggtcttctttttagtcctg
gggcttttgggtcattctcacggaggattccccaacaccatcagcataggtggacttttc
atgagaaacacagtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccaccgagaagcccttccatttgaattaccacgtagatcacttggattcc
tccaatagtttttccgtgacaaatgctttctgctcccagttctcgagaggggtgtatgcc
atctttggattctatgaccagatgtcaatgaacaccctgacctccttctgtggggccctg
cacacatcctttgttacgcctagcttccccactgacgcagatgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtcttctgggtcattacaagtgggagaag
tttgtgtacctctatgacacagaacgaggattttccatcctccaagcgattatggaagca
gcagtgcaaaacaactggcaagtaacagcaaggtctgtgggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgcgaagtcgaaaggattaacacaattttggaacaggttgtgatcctagggaaacactca
agaggttatcactacatgctcgctaacctgggttttactgatattttactggaaagagtc
atgcatgggggagccaacattacaggtttccagattgtcaacaatgaaaaccctatggtt
cagcagttcatacagcgctgggtgaggctggatgaaagggaattccctgaagccaagaat
gcaccactaaagtatacatctgcattgacacacgacgcaatactggtcatagcagaagct
ttccgctacctgaggaggcagcgagtagatgtgtcccggagaggaagtgctggagactgc
ttagcaaatcctgctgtgccctggagtcaaggaattgatattgagagagctctgaaaatg
gtgcaagtacaaggaatgactggaaatattcaatttgacacttatggacgtaggacaaat
tataccatcgatgtgtatgaaatgaaagtcagtggctctcgaaaagctggctactggaat
gagtatgaaaggtttgtgcctttctcagatcagcaaatcagcaatgacagtgcatcctca
gagaatcggaccatagtagtgactaccattctggaatcaccatatgtaatgtacaagaag
aaccatgagcaactggaaggaaatgaacgatatgaaggctattgtgtagacctagcctat
gaaatagccaaacatgtaaggatcaaatacaaattgtccatcgttggtgacgggaaatat
ggtgcaagggatccagagactaaaatatggaacggcatggttggggaacttgtctatggg
agagctgatatagctgttgctccactcactataacattggtccgtgaagaagtcatagat
ttttcaaagccattcatgagcctgggcatctccatcatgataaagaagcctcagaaatca
aaaccaggcgtattctcatttctggatcccctggcttatgaaatctggatgtgcattgtc
tttgcttacattggagtcagcgtagttcttttcctagtcagcaggttcagtccttatgaa
tggcacttggaagacaacaatgaagaacctcgtgacccacaaagtcctcctgatcctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaagga
tgtgatatttctccaagatcactctccgggcgcattgttggaggggtttggtggttcttc
accctgatcataatttcttcctatactgccaatctcgctgctttcctgactgtggagagg
atggtttctcccatagagagtgctgaagacttagctaaacagactgaaattgcatatggg
accctggactccggttcaacaaaagaatttttcagaagatccaaaattgctgtgtacgag
aaaatgtggtcttacatgaaatcagcggagccatctgtgtttaccaaaacaacagcagac
ggagtggcccgagtgcgaaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccatgtgatacgatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaggaaatgctgttaacctg
gcagtattaaaactgaatgagcaaggcctcttggacaaattgaaaaacaaatggtggtac
gacaaaggagagtgcggcagcgggggcggtgactccaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggcgttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaagcctgctcctgccaccaacactcagaattatgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaagatctag

DBGET integrated database retrieval system