KEGG   Homo sapiens (human): 2892Help
Entry
2892              CDS       T01001                                 

Gene name
GRIA3, GLUR-C, GLUR-K3, GLUR3, GLURC, GluA3, MRX94
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 3
  KO
K05199  glutamate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05202  Transcriptional misregulation in cancer
Network
N00120  MLL-ENL fusion to transcriptional activation
Disease
H00658  Syndromic X-linked mental retardation
Drug target
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2892 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2892 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2892 (GRIA3)
   04728 Dopaminergic synapse
    2892 (GRIA3)
   04730 Long-term depression
    2892 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    2892 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2892 (GRIA3)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    2892 (GRIA3)
  09164 Substance dependence
   05031 Amphetamine addiction
    2892 (GRIA3)
   05033 Nicotine addiction
    2892 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2892 (GRIA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2892 (GRIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 2892
NCBI-ProteinID: NP_000819
OMIM: 305915
HGNC: 4573
Ensembl: ENSG00000125675
Vega: OTTHUMG00000022685
Pharos: P42263(Tclin)
UniProt: P42263 Q17R51
Position
Xq25
AA seq 894 aa AA seqDB search
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaagcgtgctccgggcggtcttctttttagtcctg
gggcttttgggtcattctcacggaggattccccaacaccatcagcataggtggacttttc
atgagaaacacagtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccaccgagaagcccttccatttgaattaccacgtagatcacttggattcc
tccaatagtttttccgtgacaaatgctttctgctcccagttctcgagaggggtgtatgcc
atctttggattctatgaccagatgtcaatgaacaccctgacctccttctgtggggccctg
cacacatcctttgttacgcctagcttccccactgacgcagatgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtcttctgggtcattacaagtgggagaag
tttgtgtacctctatgacacagaacgaggattttccatcctccaagcgattatggaagca
gcagtgcaaaacaactggcaagtaacagcaaggtctgtgggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgcgaagtcgaaaggattaacacaattttggaacaggttgtgatcctagggaaacactca
agaggttatcactacatgctcgctaacctgggttttactgatattttactggaaagagtc
atgcatgggggagccaacattacaggtttccagattgtcaacaatgaaaaccctatggtt
cagcagttcatacagcgctgggtgaggctggatgaaagggaattccctgaagccaagaat
gcaccactaaagtatacatctgcattgacacacgacgcaatactggtcatagcagaagct
ttccgctacctgaggaggcagcgagtagatgtgtcccggagaggaagtgctggagactgc
ttagcaaatcctgctgtgccctggagtcaaggaattgatattgagagagctctgaaaatg
gtgcaagtacaaggaatgactggaaatattcaatttgacacttatggacgtaggacaaat
tataccatcgatgtgtatgaaatgaaagtcagtggctctcgaaaagctggctactggaat
gagtatgaaaggtttgtgcctttctcagatcagcaaatcagcaatgacagtgcatcctca
gagaatcggaccatagtagtgactaccattctggaatcaccatatgtaatgtacaagaag
aaccatgagcaactggaaggaaatgaacgatatgaaggctattgtgtagacctagcctat
gaaatagccaaacatgtaaggatcaaatacaaattgtccatcgttggtgacgggaaatat
ggtgcaagggatccagagactaaaatatggaacggcatggttggggaacttgtctatggg
agagctgatatagctgttgctccactcactataacattggtccgtgaagaagtcatagat
ttttcaaagccattcatgagcctgggcatctccatcatgataaagaagcctcagaaatca
aaaccaggcgtattctcatttctggatcccctggcttatgaaatctggatgtgcattgtc
tttgcttacattggagtcagcgtagttcttttcctagtcagcaggttcagtccttatgaa
tggcacttggaagacaacaatgaagaacctcgtgacccacaaagtcctcctgatcctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaagga
tgtgatatttctccaagatcactctccgggcgcattgttggaggggtttggtggttcttc
accctgatcataatttcttcctatactgccaatctcgctgctttcctgactgtggagagg
atggtttctcccatagagagtgctgaagacttagctaaacagactgaaattgcatatggg
accctggactccggttcaacaaaagaatttttcagaagatccaaaattgctgtgtacgag
aaaatgtggtcttacatgaaatcagcggagccatctgtgtttaccaaaacaacagcagac
ggagtggcccgagtgcgaaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccatgtgatacgatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaggaaatgctgttaacctg
gcagtattaaaactgaatgagcaaggcctcttggacaaattgaaaaacaaatggtggtac
gacaaaggagagtgcggcagcgggggcggtgactccaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggcgttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaagcctgctcctgccaccaacactcagaattatgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaagatctag

DBGET integrated database retrieval system