KEGG   Homo sapiens (human): 2893Help
Entry
2893              CDS       T01001                                 

Gene name
GRIA4, GLUR4, GLUR4C, GLURD, GluA4, NEDSGA
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 4
  KO
K05200  glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2893 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2893 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2893 (GRIA4)
   04728 Dopaminergic synapse
    2893 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    2893 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2893 (GRIA4)
 09160 Human Diseases
  09165 Substance dependence
   05031 Amphetamine addiction
    2893 (GRIA4)
   05033 Nicotine addiction
    2893 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2893 (GRIA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2893 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2893
NCBI-ProteinID: NP_000820
OMIM: 138246
HGNC: 4574
Ensembl: ENSG00000152578
Vega: OTTHUMG00000166236
Pharos: P48058(Tclin)
UniProt: P48058 Q1WWK6
Position
11q22.3
AA seq 902 aa AA seqDB search
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttccagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcaggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtattcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaggaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggagagaatggccgcgtcttgacgcctgactgcccaaag
gctgtacacactggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system