KEGG   Homo sapiens (human): 2968Help
Entry
2968              CDS       T01001                                 

Gene name
GTF2H4, P52, TFB2, TFIIH
Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Module
hsa_M00290  Holo-TFIIH complex
Network
N00225  EBV EBNA2 binding to host-cell-protein
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2968 (GTF2H4)
  Replication and repair
   03420 Nucleotide excision repair
    2968 (GTF2H4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2968 (GTF2H4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2968 (GTF2H4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2968 (GTF2H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 2968
NCBI-ProteinID: NP_001508
OMIM: 601760
HGNC: 4658
Ensembl: ENSG00000213780
Vega: OTTHUMG00000031043
Pharos: Q92759(Tbio)
UniProt: Q92759 A0A1U9X7S4
Structure
PDB: 

Position
6p21.33
AA seq 462 aa AA seqDB search
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttcaaggggactgaaccgagtacacctacaatgcaggaatctgcag
gaattcttagggggcctgagccctggggtattggaccgattgtatgggcaccctgccaca
tgtctggctgtcttcagggagctcccatccttggctaagaactgggtgatgcggatgctc
tttctggagcagcctttgccacaggctgctgtagctctgtgggtaaagaaggaattcagc
aaggctcaggaggaaagtacagggctgctgagcggcctccggatctggcacacacagctg
ctcccaggcgggctccagggcctcatcctcaaccccattttccgccagaacctccgcatt
gcccttctgggtggggggaaggcctggtctgatgacacaagtcagctgggaccagacaag
catgcccgggacgttccctcccttgacaagtacgccgaggagcgatgggaggtggtcttg
cacttcatggtgggctcccccagtgcagctgtcagccaggacttggctcagctcctcagc
caggctgggctcatgaagagtactgaacctggagagccgccctgcattacttccgctggc
ttccagttcctgttgctggacaccccggctcagctctggtactttatgttgcagtatttg
cagacagcccagagccggggcatggacctggtagagattctctccttcctcttccagctc
agcttctctactctgggcaaggattactctgtggaaggtatgagtgattctctgttgaac
ttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcggcgt
tactaccccacacgcctggccatcaatctctcatcaggtgtctctggagctgggggcact
gtgcatcagccaggtttcattgtcgtggaaaccaattaccgactgtatgcctacacggag
tcggagctgcagattgccctcattgccctcttctctgagatgctctatcggttccccaac
atggtggtggcgcaggtgacccgggagagtgtgcagcaggcaatcgccagtggcatcaca
gcccagcagataatccatttcctaaggacaagagcccacccagtgatgctcaaacagaca
cctgtgctgccccccaccatcaccgaccagatccggctctgggagctggaaagggacaga
ctccggttcactgagggtgtcctgtataaccagttcctgtcgcaagtggactttgagctg
ctgctggcccacgcgcgggagctgggcgtgctcgtgttcgagaactcggccaagcggctc
atggtggtgaccccggccgggcacagcgacgtcaagcgcttttggaagcggcagaaacat
agctcctga

DBGET integrated database retrieval system