KEGG   Homo sapiens (human): 29881
Entry
29881             CDS       T01001                                 

Gene name
NPC1L1, LDLCQ7, NPC11L1, SLC65A2
Definition
(RefSeq) NPC1 like intracellular cholesterol transporter 1
  KO
K14461  Niemann-Pick C1-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04975  Fat digestion and absorption
Drug target
Ezetimibe: D01966<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    29881 (NPC1L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    29881 (NPC1L1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC65: NPC-type cholesterol transporter
   29881 (NPC1L1)
SSDB
Motif
Pfam: Patched NPC1_N Sterol-sensing MMPL Folate_rec
Other DBs
NCBI-GeneID: 29881
NCBI-ProteinID: NP_037521
OMIM: 608010
HGNC: 7898
Ensembl: ENSG00000015520
Vega: OTTHUMG00000023691
Pharos: Q9UHC9(Tclin)
UniProt: Q9UHC9
Structure
PDB: 
3QNT

Position
7p13
AA seq 1359 aa
MAEAGLRGWLLWALLLRLAQSEPYTTIHQPGYCAFYDECGKNPELSGSLMTLSNVSCLSN
TPARKITGDHLILLQKICPRLYTGPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNF
VNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAYEAFYQHSFAEQSYDSCSRVRVPAA
ATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGV
ARCNESQGDDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTI
LLVGFRVAPARDKSKMVDPKKGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSV
IPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSY
RYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNT
SLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALAL
SCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLEEM
RAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRV
MVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLE
YQRLPRRPGEPREVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAV
ILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQGEGLLLGFFQKAYAPFL
LHWITRGVVLLLFLALFGVSLYSMCHISVGLDQELALPKDSYLLDYFLFLNRYFEVGAPV
YFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDW
LTPSSCCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRP
NIKCPKGGLAAYSTSVNLTSDGQVLDTVAILSPRLEYSGTISAHCNLYLLDSTSRFMAYH
KPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNVFYEQYLTILPEGL
FMLSLCLVPTFAVSCLLLGLDLRSGLLNLLSIVMILVDTVGFMALWGISYNAVSLINLVS
AVGMSVEFVSHITRSFAISTKPTWLERAKEATISMGSAVFAGVAMTNLPGILVLGLAKAQ
LIQIFFFRLNLLITLLGLLHGLVFLPVILSYVGPDVNPALALEQKRAEEAVAAVMVASCP
NHPSRVSTADNIYVNHSFEGSIKGAGAISNFLPNNGRQF
NT seq 4080 nt   +upstreamnt  +downstreamnt
atggcggaggccggcctgaggggctggctgctgtgggccctgctcctgcgcttggcccag
agtgagccttacacaaccatccaccagcctggctactgcgccttctatgacgaatgtggg
aagaacccagagctgtctggaagcctcatgacactctccaacgtgtcctgcctgtccaac
acgccggcccgcaagatcacaggtgatcacctgatcctattacagaagatctgcccccgc
ctctacaccggccccaacacccaagcctgctgctccgccaagcagctggtatcactggaa
gcgagtctgtcgatcaccaaggccctcctcacccgctgcccagcctgctctgacaatttt
gtgaacctgcactgccacaacacgtgcagccccaatcagagcctcttcatcaatgtgacc
cgcgtggcccagctaggggctggacaactcccagctgtggtggcctatgaggccttctac
cagcatagctttgccgagcagagctatgactcctgcagccgtgtgcgcgtccctgcagct
gccacgctggctgtgggcaccatgtgtggcgtgtatggctctgccctttgcaatgcccag
cgctggctcaacttccagggagacacaggcaatggtctggccccactggacatcaccttc
cacctcttggagcctggccaggccgtggggagtgggattcagcctctgaatgagggggtt
gcacgttgcaatgagtcccaaggtgacgacgtggcgacctgctcctgccaagactgtgct
gcatcctgtcctgccatagcccgcccccaggccctcgactccaccttctacctgggccag
atgccgggcagtctggtcctcatcatcatcctctgctctgtcttcgctgtggtcaccatc
ctgcttgtgggattccgtgtggcccccgccagggacaaaagcaagatggtggaccccaag
aagggcaccagcctctctgacaagctcagcttctccacccacaccctccttggccagttc
ttccagggctggggcacgtgggtggcttcgtggcctctgaccatcttggtgctatctgtc
atcccggtggtggccttggcagcgggcctggtctttacagaactcactacggaccccgtg
gagctgtggtcggcccccaacagccaagcccggagtgagaaagctttccatgaccagcat
ttcggccccttcttccgaaccaaccaggtgatcctgacggctcctaaccggtccagctac
aggtatgactctctgctgctggggcccaagaacttcagcggaatcctggacctggacttg
ctgctggagctgctagagctgcaggagaggctgcggcacctccaggtatggtcgcccgaa
gcacagcgcaacatctccctgcaggacatctgctacgcccccctcaatccggacaatacc
agtctctacgactgctgcatcaacagcctcctgcagtatttccagaacaaccgcacgctc
ctgctgctcacagccaaccagacactgatggggcagacctcccaagtcgactggaaggac
cattttctgtactgtgccaatgccccgctcaccttcaaggatggcacagccctggccctg
agctgcatggctgactacggggcccctgtcttccccttccttgccattggggggtacaaa
ggaaaggactattctgaggcagaggccctgatcatgacgttctccctcaacaattaccct
gccggggacccccgtctggcccaggccaagctgtgggaggaggccttcttagaggaaatg
cgagccttccagcgtcggatggctggcatgttccaggtcacgttcatggctgagcgctct
ctggaagacgagatcaatcgcaccacagctgaagacctgcccatctttgccaccagctac
attgtcatattcctgtacatctctctggccctgggcagctattccagctggagccgagtg
atggtggactccaaggccacgctgggcctcggcggggtggccgtggtcctgggagcagtc
atggctgccatgggcttcttctcctacttgggtatccgctcctccctggtcatcctgcaa
gtggttcctttcctggtgctgtccgtgggggctgataacatcttcatctttgttctcgag
taccagaggctgccccggaggcctggggagccacgagaggtccacattgggcgagcccta
ggcagggtggctcccagcatgctgttgtgcagcctctctgaggccatctgcttcttccta
ggggccctgacccccatgccagctgtgcggacctttgccctgacctctggccttgcagtg
atccttgacttcctcctgcagatgtcagcctttgtggccctgctctccctggacagcaag
aggcaggaggcctcccggttggacgtctgctgctgtgtcaagccccaggagctgcccccg
cctggccagggagaggggctcctgcttggcttcttccaaaaggcttatgcccccttcctg
ctgcactggatcactcgaggtgttgtgctgctgctgtttctcgccctgttcggagtgagc
ctctactccatgtgccacatcagcgtgggactggaccaggagctggccctgcccaaggac
tcgtacctgcttgactatttcctctttctgaaccgctacttcgaggtgggggccccggtg
tactttgttaccaccttgggctacaacttctccagcgaggctgggatgaatgccatctgc
tccagtgcaggctgcaacaacttctccttcacccagaagatccagtatgccacagagttc
cctgagcagtcttacctggccatccctgcctcctcctgggtggatgacttcattgactgg
ctgaccccgtcctcctgctgccgcctttatatatctggccccaataaggacaagttctgc
ccctcgaccgtcaactctctgaactgcctaaagaactgcatgagcatcacgatgggctct
gtgaggccctcggtggagcagttccataagtatcttccctggttcctgaacgaccggccc
aacatcaaatgtcccaaaggcggcctggcagcatacagcacctctgtgaacttgacttca
gatggccaggttttagacacagttgccattctgtcacccaggctggagtacagtggcaca
atctcggctcactgcaacctctacctcctggattcaacctccaggttcatggcctatcac
aagcccctgaaaaactcacaggattacacagaagctctgcgggcagctcgagagctggca
gccaacatcactgctgacctgcggaaagtgcctggaacagacccggcttttgaggtcttc
ccctacacgatcaccaatgtgttttatgagcagtacctgaccatcctccctgaggggctc
ttcatgctcagcctctgccttgtgcccaccttcgctgtctcctgcctcctgctgggcctg
gacctgcgctccggcctcctcaacctgctctccattgtcatgatcctcgtggacactgtc
ggcttcatggccctgtggggcatcagttacaatgctgtgtccctcatcaacctggtctcg
gcggtgggcatgtctgtggagtttgtgtcccacattacccgctcctttgccatcagcacc
aagcccacctggctggagagggccaaagaggccaccatctctatgggaagtgcggtgttt
gcaggtgtggccatgaccaacctgcctggcatccttgtcctgggcctcgccaaggcccag
ctcattcagatcttcttcttccgcctcaacctcctgatcactctgctgggcctgctgcat
ggcttggtcttcctgcccgtcatcctcagctacgtggggcctgacgttaacccggctctg
gcactggagcagaagcgggctgaggaggcggtggcagcagtcatggtggcctcttgccca
aatcacccctcccgagtctccacagctgacaacatctatgtcaaccacagctttgaaggt
tctatcaaaggtgctggtgccatcagcaacttcttgcccaacaatgggcggcagttctga

DBGET integrated database retrieval system