KEGG   Homo sapiens (human): 29893
Entry
29893             CDS       T01001                                 

Gene name
PSMC3IP, GT198, HOP2, HUMGT198A, ODG3, TBPIP
Definition
(RefSeq) PSMC3 interacting protein
  KO
K06695  26S proteasome regulatory subunit, ATPase 3, interacting protein
Organism
hsa  Homo sapiens (human)
Disease
H00599  Ovarian dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    29893 (PSMC3IP)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   Other PIPs
    29893 (PSMC3IP)
SSDB
Motif
Pfam: TBPIP LZ3wCH Penicillinase_R Snapin_Pallidin Ax_dynein_light Spc24 SlyX CorA DivIC Syntaxin Seryl_tRNA_N Mnd1 FUR Cnn_1N APG6_N Atg14 CENP-F_leu_zip ATG16 NPV_P10 FapA SKA2 TMPIT FlxA Wtap CCDC-167 ADIP YabA ZapB
Other DBs
NCBI-GeneID: 29893
NCBI-ProteinID: NP_057640
OMIM: 608665
HGNC: 17928
Ensembl: ENSG00000131470
Vega: OTTHUMG00000180247
Pharos: Q9P2W1(Tbio)
UniProt: Q9P2W1 A0A158RUX1
Position
17q21.2
AA seq 217 aa
MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKI
KEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSA
LTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMA
TELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP
NT seq 654 nt   +upstreamnt  +downstreamnt
atgagtaaaggccgggcagaagctgcggcgggagccgccgggatcctcctgaggtacctg
caggagcagaaccggccctacagctcccaggatgtgttcgggaacctacagcgggaacac
ggactgggcaaggcggtggtggtgaagacgctggagcagctggcgcaacaaggcaagatc
aaagagaagatgtacggcaagcagaagatctattttgcggatcaggaccagtttgacatg
gtgagtgatgctgaccttcaagtcctagatggcaaaatcgtggccctcactgctaaggtg
cagagcttgcagcagagctgccgctacatggaggctgagctcaaggaattatctagtgcc
ctgaccacaccagagatgcagaaagaaatccaggagttaaagaaggaatgcgctggctac
agagagagattgaagaacattaaagcagctaccaatcatgtgactccagaagagaaagag
caggtgtacagagagaggcagaagtactgtaaggagtggaggaagaggaagaggatggct
acagagctgtctgatgcaatacttgaaggataccccaagagcaagaagcagttctttgag
gaagttgggatagagacggatgaagattacaacgtcacactcccagacccctga

DBGET integrated database retrieval system