KEGG   Homo sapiens (human): 3037Help
Entry
3037              CDS       T01001                                 

Gene name
HAS2
Definition
(RefSeq) hyaluronan synthase 2
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3037 (HAS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     3037 (HAS2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3037 (HAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chitin_synth_2 Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Phage_holin_8
Motif
Other DBs
NCBI-GeneID: 3037
NCBI-ProteinID: NP_005319
OMIM: 601636
HGNC: 4819
Ensembl: ENSG00000170961
Vega: OTTHUMG00000164953
Pharos: Q92819(Tbio)
UniProt: Q92819
Position
8q24.13
AA seq 552 aa AA seqDB search
MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ
SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI
DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKS
ICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG
DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY
NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR
EWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP
VSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR
KKGQQYDMVLDV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtgagaggtttctatgtatcctgagaataattggaaccacactctttggagtc
tctctcctccttggaatcacagctgcttatattgttggctaccagtttatccaaacggat
aattactatttctcttttggactgtatggtgcctttttggcatcacacctcatcatccaa
agcctgtttgcctttttggagcaccgaaaaatgaaaaaatccctagaaacccccataaag
ttgaacaaaacagttgccctttgcatcgctgcctatcaagaagatccagactacttaagg
aaatgtttgcaatctgtgaaaaggctaacctaccctgggattaaagttgtcatggtcata
gatgggaactcagaagatgacctttacatgatggacatcttcagtgaagtcatgggcaga
gacaaatcagccacttatatctggaagaacaacttccacgaaaagggtcccggtgagaca
gatgagtcacataaagaaagctcgcaacacgtaacgcaattggtcttgtccaacaaaagt
atctgcatcatgcaaaaatggggtggaaaaagagaagtcatgtacacagccttcagagca
ctgggacgaagtgtggattatgtacaggtttgtgattcagacactatgcttgacccagcc
tcatctgtggagatggtaaaagttttagaagaagatcccatggttggaggtgttggggga
gatgtccagattttaaacaagtacgattcctggatctcattcctcagcagtgtaagatat
tggatggcttttaatatagaaagggcctgtcagtcttattttgggtgtgttcagtgcatt
agtggacctctgggaatgtacagaaactccttgttgcatgagtttgtggaagattggtac
aatcaagaatttatgggcaaccaatgtagctttggtgatgacaggcatctcacgaaccgg
gtgctgagcctgggctatgcaacaaaatacacagctcgatctaagtgccttactgaaaca
cctatagaatatctcagatggctaaaccagcagacccgttggagcaagtcctacttccga
gaatggctgtacaatgcaatgtggtttcacaaacatcacttgtggatgacctacgaagcg
attatcactggattctttcctttctttctcattgccacagtaatccagctcttctaccgg
ggtaaaatttggaacattctcctcttcttgttaactgtccagctagtaggtctcataaaa
tcatcttttgccagctgccttagaggaaatatcgtcatggtcttcatgtctctctactca
gtgttatacatgtcgagtttacttcccgccaagatgtttgcaattgcaacaataaacaaa
gctgggtggggcacatcaggaaggaaaaccattgttgttaatttcataggactcattcca
gtatcagtttggtttacaatcctcctgggtggtgtgattttcaccatttataaggagtct
aaaaggccattttcagaatccaaacagacagttctaattgttggaacgttgctctatgca
tgctattgggtcatgcttttgacgctgtatgtagttctcatcaataagtgtggcaggcgg
aagaagggacaacaatatgacatggtgcttgatgtatga

DBGET integrated database retrieval system