KEGG   Homo sapiens (human): 3038
Entry
3038              CDS       T01001                                 

Gene name
HAS3
Definition
(RefSeq) hyaluronan synthase 3
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3038 (HAS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     3038 (HAS3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3038 (HAS3)
SSDB
Motif
Pfam: Glyco_tranf_2_3 Chitin_synth_2 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 DUF1294
Other DBs
NCBI-GeneID: 3038
NCBI-ProteinID: NP_001186209
OMIM: 602428
HGNC: 4820
Ensembl: ENSG00000103044
Vega: OTTHUMG00000137562
Pharos: O00219(Tbio)
UniProt: O00219
Position
16q22.1
AA seq 553 aa
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM
VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA
STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG
VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS
YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG
LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG
KKPEQYSLAFAEV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgccggtgcagctgacgacagccctgcgtgtggtgggcaccagcctgtttgccctggca
gtgctgggtggcatcctggcagcctatgtgacgggctaccagttcatccacacggaaaag
cactacctgtccttcggcctgtacggcgccatcctgggcctgcacctgctcattcagagc
ctttttgccttcctggagcaccggcgcatgcgacgtgccggccaggccctgaagctgccc
tccccgcggcggggctcggtggcactgtgcattgccgcataccaggaggaccctgactac
ttgcgcaagtgcctgcgctcggcccagcgcatctccttccctgacctcaaggtggtcatg
gtggtggatggcaaccgccaggaggacgcctacatgctggacatcttccacgaggtgctg
ggcggcaccgagcaggccggcttctttgtgtggcgcagcaacttccatgaggcaggcgag
ggtgagacggaggccagcctgcaggagggcatggaccgtgtgcgggatgtggtgcgggcc
agcaccttctcgtgcatcatgcagaagtggggaggcaagcgcgaggtcatgtacacggcc
ttcaaggccctcggcgattcggtggactacatccaggtgtgcgactctgacactgtgctg
gatccagcctgcaccatcgagatgcttcgagtcctggaggaggatccccaagtaggggga
gtcgggggagatgtccagatcctcaacaagtacgactcatggatttccttcctgagcagc
gtgcggtactggatggccttcaacgtggagcgggcctgccagtcctactttggctgtgtg
cagtgtattagtgggcccttgggcatgtaccgcaacagcctcctccagcagttcctggag
gactggtaccatcagaagttcctaggcagcaagtgcagcttcggggatgaccggcacctc
accaaccgagtcctgagccttggctaccgaactaagtataccgcgcgctccaagtgcctc
acagagacccccactaagtacctccggtggctcaaccagcaaacccgctggagcaagtct
tacttccgggagtggctctacaactctctgtggttccataagcaccacctctggatgacc
tacgagtcagtggtcacgggtttcttccccttcttcctcattgccacggttatacagctt
ttctaccggggccgcatctggaacattctcctcttcctgctgacggtgcagctggtgggc
attatcaaggccacctacgcctgcttccttcggggcaatgcagagatgatcttcatgtcc
ctctactccctcctctatatgtccagccttctgccggccaagatctttgccattgctacc
atcaacaaatctggctggggcacctctggccgaaaaaccattgtggtgaacttcattggc
ctcattcctgtgtccatctgggtggcagttctcctgggagggctggcctacacagcttat
tgccaggacctgttcagtgagacagagctagccttccttgtctctggggctatactgtat
ggctgctactgggtggccctcctcatgctatatctggccatcatcgcccggcgatgtggg
aagaagccggagcagtacagcttggcttttgctgaggtgtga

DBGET integrated database retrieval system