KEGG   Homo sapiens (human): 3055Help
Entry
3055              CDS       T01001                                 

Gene name
HCK, JTK9, p59Hck, p61Hck
Definition
(RefSeq) HCK proto-oncogene, Src family tyrosine kinase
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    3055 (HCK)
   04062 Chemokine signaling pathway
    3055 (HCK)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    3055 (HCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3055 (HCK)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3055 (HCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3055 (HCK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   3055 (HCK)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    3055 (HCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3055
NCBI-ProteinID: NP_002101
OMIM: 142370
HGNC: 4840
Ensembl: ENSG00000101336
Vega: OTTHUMG00000032204
Pharos: P08631(Tclin)
UniProt: P08631 F6SF04
Structure
PDB: 

Position
20q11.21
AA seq 526 aa AA seqDB search
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ctgggggggcgctcaagctgcgaggatccgggctgcccgcgagacgaggagcgggcgccc
aggatggggtgcatgaagtccaagttcctccaggtcggaggcaatacattctcaaaaact
gaaaccagcgccagcccacactgtcctgtgtacgtgccggatcccacatccaccatcaag
ccggggcctaatagccacaacagcaacacaccaggaatcagggaggcaggctctgaggac
atcatcgtggttgccctgtatgattacgaggccattcaccacgaagacctcagcttccag
aagggggaccagatggtggtcctagaggaatccggggagtggtggaaggctcgatccctg
gccacccggaaggagggctacatcccaagcaactatgtcgcccgcgttgactctctggag
acagaggagtggtttttcaagggcatcagccggaaggacgcagagcgccaactgctggct
cccggcaacatgctgggctccttcatgatccgggatagcgagaccactaaaggaagctac
tctttgtccgtgcgagactacgaccctcggcagggagataccgtgaaacattacaagatc
cggaccctggacaacgggggcttctacatatccccccgaagcaccttcagcactctgcag
gagctggtggaccactacaagaaggggaacgacgggctctgccagaaactgtcggtgccc
tgcatgtcttccaagccccagaagccttgggagaaagatgcctgggagatccctcgggaa
tccctcaagctggagaagaaacttggagctgggcagtttggggaagtctggatggccacc
tacaacaagcacaccaaggtggcagtgaagacgatgaagccagggagcatgtcggtggag
gccttcctggcagaggccaacgtgatgaaaactctgcagcatgacaagctggtcaaactt
catgcggtggtcaccaaggagcccatctacatcatcacggagttcatggccaaaggaagc
ttgctggactttctgaaaagtgatgagggcagcaagcagccattgccaaaactcattgac
ttctcagcccagattgcagaaggcatggccttcatcgagcagaggaactacatccaccga
gacctccgagctgccaacatcttggtctctgcatccctggtgtgtaagattgctgacttt
ggcctggcccgggtcattgaggacaacgagtacacggctcgggaaggggccaagttcccc
atcaagtggacagctcctgaagccatcaactttggctccttcaccatcaagtcagacgtc
tggtcctttggtatcctgctgatggagatcgtcacctacggccggatcccttacccaggg
atgtcaaaccctgaagtgatccgagctctggagcgtggataccggatgcctcgcccagag
aactgcccagaggagctctacaacatcatgatgcgctgctggaaaaaccgtccggaggag
cggccgaccttcgaatacatccagagtgtgctggatgacttctacacggccacagagagc
cagtaccaacagcagccatga

DBGET integrated database retrieval system