KEGG   Homo sapiens (human): 3105
Entry
3105              CDS       T01001                                 

Gene name
HLA-A, HLAA
Definition
(RefSeq) major histocompatibility complex, class I, A
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3105 (HLA-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3105 (HLA-A)
   04145 Phagosome
    3105 (HLA-A)
  09143 Cell growth and death
   04218 Cellular senescence
    3105 (HLA-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3105 (HLA-A)
   04612 Antigen processing and presentation
    3105 (HLA-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3105 (HLA-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3105 (HLA-A)
   05330 Allograft rejection
    3105 (HLA-A)
   05332 Graft-versus-host disease
    3105 (HLA-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3105 (HLA-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3105 (HLA-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3105 (HLA-A)
   05170 Human immunodeficiency virus 1 infection
    3105 (HLA-A)
   05168 Herpes simplex virus 1 infection
    3105 (HLA-A)
   05163 Human cytomegalovirus infection
    3105 (HLA-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3105 (HLA-A)
   05169 Epstein-Barr virus infection
    3105 (HLA-A)
   05165 Human papillomavirus infection
    3105 (HLA-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3105 (HLA-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3105 (HLA-A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3105 (HLA-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3105 (HLA-A)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 3105
NCBI-ProteinID: NP_001229687
OMIM: 142800
HGNC: 4931
Ensembl: ENSG00000206503
Vega: OTTHUMG00000130501
Pharos: P30443(Tbio)
UniProt: P04439 Q5SUL5
Structure
PDB: 

Position
6p22.1
AA seq 365 aa
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccgtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactccatgaggtatttcttcacatccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaagatggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccaggagacacggaatatgaaggcccactcacagactgaccgagcg
aacctggggaccctgcgcggctactacaaccagagcgaggacggttctcacaccatccag
ataatgtatggctgcgacgtggggccggacgggcgcttcctccgcgggtaccggcaggac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg
gacatggcagctcagatcaccaagcgcaagtgggaggcggtccatgcggcggagcagcgg
agagtctacctggagggccggtgcgtggacgggctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagctg
tcttcccagcccaccatccccatcgtgggcatcattgctggcctggttctccttggagct
gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa
ggagggagttacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Homo sapiens (human): 3106
Entry
3106              CDS       T01001                                 

Gene name
HLA-B, AS, B-4901, HLAB
Definition
(RefSeq) major histocompatibility complex, class I, B
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01476  Behcet disease
H01507  Seronegative arthritis
H01674  Ankylosing spondylitis
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3106 (HLA-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3106 (HLA-B)
   04145 Phagosome
    3106 (HLA-B)
  09143 Cell growth and death
   04218 Cellular senescence
    3106 (HLA-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3106 (HLA-B)
   04612 Antigen processing and presentation
    3106 (HLA-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3106 (HLA-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3106 (HLA-B)
   05330 Allograft rejection
    3106 (HLA-B)
   05332 Graft-versus-host disease
    3106 (HLA-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3106 (HLA-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3106 (HLA-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3106 (HLA-B)
   05170 Human immunodeficiency virus 1 infection
    3106 (HLA-B)
   05168 Herpes simplex virus 1 infection
    3106 (HLA-B)
   05163 Human cytomegalovirus infection
    3106 (HLA-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3106 (HLA-B)
   05169 Epstein-Barr virus infection
    3106 (HLA-B)
   05165 Human papillomavirus infection
    3106 (HLA-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3106 (HLA-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3106 (HLA-B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3106 (HLA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3106 (HLA-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 3106
NCBI-ProteinID: NP_005505
OMIM: 142830
HGNC: 4932
Ensembl: ENSG00000234745
Vega: OTTHUMG00000031153
Pharos: P01889(Tbio)
UniProt: P01889 E5FQ95
Structure
PDB: 

Position
6p21.33
AA seq 362 aa
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

KEGG   Homo sapiens (human): 3107
Entry
3107              CDS       T01001                                 

Gene name
HLA-C, D6S204, HLA-JY3, HLAC, HLC-C, MHC, PSORS1
Definition
(RefSeq) major histocompatibility complex, class I, C
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01656  Psoriasis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3107 (HLA-C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3107 (HLA-C)
   04145 Phagosome
    3107 (HLA-C)
  09143 Cell growth and death
   04218 Cellular senescence
    3107 (HLA-C)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3107 (HLA-C)
   04612 Antigen processing and presentation
    3107 (HLA-C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3107 (HLA-C)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3107 (HLA-C)
   05330 Allograft rejection
    3107 (HLA-C)
   05332 Graft-versus-host disease
    3107 (HLA-C)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3107 (HLA-C)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3107 (HLA-C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3107 (HLA-C)
   05170 Human immunodeficiency virus 1 infection
    3107 (HLA-C)
   05168 Herpes simplex virus 1 infection
    3107 (HLA-C)
   05163 Human cytomegalovirus infection
    3107 (HLA-C)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3107 (HLA-C)
   05169 Epstein-Barr virus infection
    3107 (HLA-C)
   05165 Human papillomavirus infection
    3107 (HLA-C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3107 (HLA-C)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3107 (HLA-C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3107 (HLA-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3107 (HLA-C)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 MHC_I_3 ig FeoB_associated
Other DBs
NCBI-GeneID: 3107
NCBI-ProteinID: NP_002108
OMIM: 142840
HGNC: 4933
Ensembl: ENSG00000204525
Vega: OTTHUMG00000031154
Pharos: P10321(Tbio)
UniProt: P10321 Q6R739 Q95HC2
Structure
PDB: 
5W6A 5W67 5VGE 5W69

Position
6p21.33
AA seq 366 aa
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgagccctcctcctgctgctctcgggaggcctggccctgacc
gagacctgggcctgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatctcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
agcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccctccag
aggatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagttggaggcggcccgtgcggcggagcagctg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagctgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcaccgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

KEGG   Homo sapiens (human): 3108
Entry
3108              CDS       T01001                                 

Gene name
HLA-DMA, D6S222E, DMA, HLADM, RING6
Definition
(RefSeq) major histocompatibility complex, class II, DM alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00083  Allograft rejection
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3108 (HLA-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3108 (HLA-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3108 (HLA-DMA)
   04612 Antigen processing and presentation
    3108 (HLA-DMA)
   04658 Th1 and Th2 cell differentiation
    3108 (HLA-DMA)
   04659 Th17 cell differentiation
    3108 (HLA-DMA)
   04672 Intestinal immune network for IgA production
    3108 (HLA-DMA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3108 (HLA-DMA)
   05322 Systemic lupus erythematosus
    3108 (HLA-DMA)
   05323 Rheumatoid arthritis
    3108 (HLA-DMA)
   05320 Autoimmune thyroid disease
    3108 (HLA-DMA)
   05321 Inflammatory bowel disease
    3108 (HLA-DMA)
   05330 Allograft rejection
    3108 (HLA-DMA)
   05332 Graft-versus-host disease
    3108 (HLA-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3108 (HLA-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3108 (HLA-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3108 (HLA-DMA)
   05152 Tuberculosis
    3108 (HLA-DMA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3108 (HLA-DMA)
   05164 Influenza A
    3108 (HLA-DMA)
   05168 Herpes simplex virus 1 infection
    3108 (HLA-DMA)
   05169 Epstein-Barr virus infection
    3108 (HLA-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3108 (HLA-DMA)
   05140 Leishmaniasis
    3108 (HLA-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3108 (HLA-DMA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3108 (HLA-DMA)
  Exosomal proteins of epithelial cells
   3108 (HLA-DMA)
  Exosomal proteins of breast milk
   3108 (HLA-DMA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 FAST_1
Other DBs
NCBI-GeneID: 3108
NCBI-ProteinID: NP_006111
OMIM: 142855
HGNC: 4934
Ensembl: ENSG00000204257
Vega: OTTHUMG00000031173
UniProt: Q31604 Q6ICR9
Structure
PDB: 
2BC4 1HDM 4FQX 4GBX 4I0P

Position
6p21.32
AA seq 261 aa
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVD
GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtcatgaacagaaccaaggagctgcgctgctacagatgttaccacttctgtggctg
ctaccccactcctgggccgtccctgaagctcctactccaatgtggccagatgacctgcaa
aaccacacattcctgcacacagtgtactgccaggatgggagtcccagtgtgggactctct
gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct
cgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt
gacaaagagttctgcgagtggatgatccagcaaatagggccaaaacttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaagtgttcacgctgaagcccctggagtttggc
aagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggatttgggcctacttttgtctcagctgtcgat
ggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtaccccgg
aacgcactgccctcagatctgctggagaatgtgctgtgtggcgtggcctttggcctgggt
gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt
gactga

KEGG   Homo sapiens (human): 3109
Entry
3109              CDS       T01001                                 

Gene name
HLA-DMB, D6S221E, RING7
Definition
(RefSeq) major histocompatibility complex, class II, DM beta
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3109 (HLA-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3109 (HLA-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3109 (HLA-DMB)
   04612 Antigen processing and presentation
    3109 (HLA-DMB)
   04658 Th1 and Th2 cell differentiation
    3109 (HLA-DMB)
   04659 Th17 cell differentiation
    3109 (HLA-DMB)
   04672 Intestinal immune network for IgA production
    3109 (HLA-DMB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3109 (HLA-DMB)
   05322 Systemic lupus erythematosus
    3109 (HLA-DMB)
   05323 Rheumatoid arthritis
    3109 (HLA-DMB)
   05320 Autoimmune thyroid disease
    3109 (HLA-DMB)
   05321 Inflammatory bowel disease
    3109 (HLA-DMB)
   05330 Allograft rejection
    3109 (HLA-DMB)
   05332 Graft-versus-host disease
    3109 (HLA-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3109 (HLA-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3109 (HLA-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3109 (HLA-DMB)
   05152 Tuberculosis
    3109 (HLA-DMB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3109 (HLA-DMB)
   05164 Influenza A
    3109 (HLA-DMB)
   05168 Herpes simplex virus 1 infection
    3109 (HLA-DMB)
   05169 Epstein-Barr virus infection
    3109 (HLA-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3109 (HLA-DMB)
   05140 Leishmaniasis
    3109 (HLA-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3109 (HLA-DMB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3109 (HLA-DMB)
  Exosomal proteins of epithelial cells
   3109 (HLA-DMB)
  Exosomal proteins of breast milk
   3109 (HLA-DMB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 3109
NCBI-ProteinID: NP_002109
OMIM: 142856
HGNC: 4935
Ensembl: ENSG00000242574
Vega: OTTHUMG00000031176
Pharos: P28068(Tbio)
UniProt: P28068 A0A1V0E3P2
Structure
PDB: 
2BC4 1HDM 4FQX 4GBX 4I0P

Position
6p21.32
AA seq 263 aa
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGWHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcacattcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc
ttcgtggcccatgtggaaagcacctgtctgttggatgatgctgggactccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag
atggccccttgcgaatttggggtgctgaatagcttggcgaatgtcctctcacagcacctc
aaccaaaaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac
acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagaagtgactatcacgtggaggaagaacgggaagcttgtcatgcctcacagc
agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta
gccttaaccccctcttacggggacacttacacctgtgtggtagagcacactggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagctgg
cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggatgg
cacatttcctag

KEGG   Homo sapiens (human): 3111
Entry
3111              CDS       T01001                                 

Gene name
HLA-DOA, HLA-DNA, HLA-DZA, HLADZ
Definition
(RefSeq) major histocompatibility complex, class II, DO alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3111 (HLA-DOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3111 (HLA-DOA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3111 (HLA-DOA)
   04612 Antigen processing and presentation
    3111 (HLA-DOA)
   04658 Th1 and Th2 cell differentiation
    3111 (HLA-DOA)
   04659 Th17 cell differentiation
    3111 (HLA-DOA)
   04672 Intestinal immune network for IgA production
    3111 (HLA-DOA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3111 (HLA-DOA)
   05322 Systemic lupus erythematosus
    3111 (HLA-DOA)
   05323 Rheumatoid arthritis
    3111 (HLA-DOA)
   05320 Autoimmune thyroid disease
    3111 (HLA-DOA)
   05321 Inflammatory bowel disease
    3111 (HLA-DOA)
   05330 Allograft rejection
    3111 (HLA-DOA)
   05332 Graft-versus-host disease
    3111 (HLA-DOA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3111 (HLA-DOA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3111 (HLA-DOA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3111 (HLA-DOA)
   05152 Tuberculosis
    3111 (HLA-DOA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3111 (HLA-DOA)
   05164 Influenza A
    3111 (HLA-DOA)
   05168 Herpes simplex virus 1 infection
    3111 (HLA-DOA)
   05169 Epstein-Barr virus infection
    3111 (HLA-DOA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3111 (HLA-DOA)
   05140 Leishmaniasis
    3111 (HLA-DOA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3111 (HLA-DOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3111 (HLA-DOA)
  Exosomal proteins of epithelial cells
   3111 (HLA-DOA)
  Exosomal proteins of breast milk
   3111 (HLA-DOA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 3111
NCBI-ProteinID: NP_002110
OMIM: 142930
HGNC: 4936
Ensembl: ENSG00000204252
Vega: OTTHUMG00000031211
Pharos: P06340(Tbio)
UniProt: P06340 X5CF87 A0A1V0E3Q8 A0A1V0E3S6 A0A1V0E3R8 A0A1V0E3Q1 A0A1V0E3N6 A0A1V0E3P3 A0A1V0E3Q3 A0A1V0E3S4 A0A1V0E3P8 A0A1V0E3Q4 A0A1V0E3R4 A0A1V0E3N7 A0A1V0E3R0 A0A1V0E3R3 A0A1V0E3N1 A0A1V0E3N3 A0A1V0E3P0 A0A1V0E3R6 A0A1V0E3Q7 A0A1V0E3Q5 A0A1V0E3P1 A0A1V0E3M7 A0A1V0E3P9 A0A1V0E3P6 A0A1V0E3Q2 A0A1V0E3T1 A0A1V0E3S0 A0A1V0E3S7 A0A1V0E3Q6
Structure
PDB: 
4I0P

Position
6p21.32
AA seq 250 aa
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctggtcctggggttccacaccctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggcgcctcgggccagttcacccatgaatttgatgaggaacagctgttctctgtg
gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggtgactttgcccgcttt
gacccgcagggcgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg
gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag
tctcgggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaacggccaaactgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagccgaggacgtctatgactgccaggtggagcactggggcctggatgcgccactc
ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc
tgtgccctgggcctggccatcggcctggtgggcttcctcgtgggcaccgtcctcatcatc
atgggcacatatgtgtccagtgtccccaggtaa

KEGG   Homo sapiens (human): 3112
Entry
3112              CDS       T01001                                 

Gene name
HLA-DOB, DOB, HLA_DOB
Definition
(RefSeq) major histocompatibility complex, class II, DO beta
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3112 (HLA-DOB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3112 (HLA-DOB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3112 (HLA-DOB)
   04612 Antigen processing and presentation
    3112 (HLA-DOB)
   04658 Th1 and Th2 cell differentiation
    3112 (HLA-DOB)
   04659 Th17 cell differentiation
    3112 (HLA-DOB)
   04672 Intestinal immune network for IgA production
    3112 (HLA-DOB)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3112 (HLA-DOB)
   05322 Systemic lupus erythematosus
    3112 (HLA-DOB)
   05323 Rheumatoid arthritis
    3112 (HLA-DOB)
   05320 Autoimmune thyroid disease
    3112 (HLA-DOB)
   05321 Inflammatory bowel disease
    3112 (HLA-DOB)
   05330 Allograft rejection
    3112 (HLA-DOB)
   05332 Graft-versus-host disease
    3112 (HLA-DOB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3112 (HLA-DOB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3112 (HLA-DOB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3112 (HLA-DOB)
   05152 Tuberculosis
    3112 (HLA-DOB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3112 (HLA-DOB)
   05164 Influenza A
    3112 (HLA-DOB)
   05168 Herpes simplex virus 1 infection
    3112 (HLA-DOB)
   05169 Epstein-Barr virus infection
    3112 (HLA-DOB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3112 (HLA-DOB)
   05140 Leishmaniasis
    3112 (HLA-DOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3112 (HLA-DOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3112 (HLA-DOB)
  Exosomal proteins of epithelial cells
   3112 (HLA-DOB)
  Exosomal proteins of breast milk
   3112 (HLA-DOB)
SSDB
Motif
Pfam: MHC_II_beta C1-set ig C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 3112
NCBI-ProteinID: NP_002111
OMIM: 600629
HGNC: 4937
Ensembl: ENSG00000241106
Vega: OTTHUMG00000031213
Pharos: P13765(Tbio)
UniProt: P13765 Q5QNS2
Structure
PDB: 
4I0P

Position
6p21.32
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc
gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg
ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaagtggttcctgaat
gggcaggaggagagagctggggtcatgtccactggccctatcaggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt
gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat
tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt
aatgaggtctcaagagctgttctgctccctcagtcatgctaa

KEGG   Homo sapiens (human): 3113
Entry
3113              CDS       T01001                                 

Gene name
HLA-DPA1, DP(W3), DP(W4), DPA1, HLA-DP1A, HLA-DPB1, HLADP, HLASB, PLT1
Definition
(RefSeq) major histocompatibility complex, class II, DP alpha 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00294  Dilated cardiomyopathy
H01492  Systemic sclerosis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3113 (HLA-DPA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3113 (HLA-DPA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3113 (HLA-DPA1)
   04612 Antigen processing and presentation
    3113 (HLA-DPA1)
   04658 Th1 and Th2 cell differentiation
    3113 (HLA-DPA1)
   04659 Th17 cell differentiation
    3113 (HLA-DPA1)
   04672 Intestinal immune network for IgA production
    3113 (HLA-DPA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3113 (HLA-DPA1)
   05322 Systemic lupus erythematosus
    3113 (HLA-DPA1)
   05323 Rheumatoid arthritis
    3113 (HLA-DPA1)
   05320 Autoimmune thyroid disease
    3113 (HLA-DPA1)
   05321 Inflammatory bowel disease
    3113 (HLA-DPA1)
   05330 Allograft rejection
    3113 (HLA-DPA1)
   05332 Graft-versus-host disease
    3113 (HLA-DPA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3113 (HLA-DPA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3113 (HLA-DPA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3113 (HLA-DPA1)
   05152 Tuberculosis
    3113 (HLA-DPA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3113 (HLA-DPA1)
   05164 Influenza A
    3113 (HLA-DPA1)
   05168 Herpes simplex virus 1 infection
    3113 (HLA-DPA1)
   05169 Epstein-Barr virus infection
    3113 (HLA-DPA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3113 (HLA-DPA1)
   05140 Leishmaniasis
    3113 (HLA-DPA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3113 (HLA-DPA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3113 (HLA-DPA1)
  Exosomal proteins of epithelial cells
   3113 (HLA-DPA1)
  Exosomal proteins of breast milk
   3113 (HLA-DPA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 3113
NCBI-ProteinID: NP_001229453
OMIM: 142880
HGNC: 4938
Ensembl: ENSG00000231389
Vega: OTTHUMG00000031058
Pharos: P20036(Tbio)
UniProt: P20036 X5CKE2
Structure
PDB: 

Position
6p21.32
AA seq 260 aa
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgccctgaagacagaatgttccatatcagagctgtgatcttgagagccctctccttg
gctttcctgctgagtctccgaggagctggggccatcaaggcggaccatgtgtcaacttat
gccgcgtttgtacagacgcatagaccaacaggggagtttatgtttgaatttgatgaagat
gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc
caagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac
ttgaataccttgatccagcgttccaaccacactcaggccaccaacgatccccctgaggtg
accgtgtttcccaaggagcctgtggagctgggccagcccaacaccctcatctgccacatt
gacaagttcttcccaccagtgctcaacgtcacgtggctgtgcaacggggagctggtcact
gagggtgtcgctgagagcctcttcctgcccagaacagattacagcttccacaagttccat
tacctgacctttgtgccctcagcagaggacttctatgactgcagggtggagcactggggc
ttggaccagccgctcctcaagcactgggaggcccaagagccaatccagatgcctgagaca
acggagactgtgctctgtgccctgggcctggtgctgggcctagtcggcatcatcgtgggc
accgtcctcatcataaagtctctgcgttctggccatgacccccgggcccaggggaccctg
tga

KEGG   Homo sapiens (human): 3115
Entry
3115              CDS       T01001                                 

Gene name
HLA-DPB1, DPB1, HLA-DP, HLA-DP1B, HLA-DPB
Definition
(RefSeq) major histocompatibility complex, class II, DP beta 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00294  Dilated cardiomyopathy
H01492  Systemic sclerosis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3115 (HLA-DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3115 (HLA-DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3115 (HLA-DPB1)
   04612 Antigen processing and presentation
    3115 (HLA-DPB1)
   04658 Th1 and Th2 cell differentiation
    3115 (HLA-DPB1)
   04659 Th17 cell differentiation
    3115 (HLA-DPB1)
   04672 Intestinal immune network for IgA production
    3115 (HLA-DPB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3115 (HLA-DPB1)
   05322 Systemic lupus erythematosus
    3115 (HLA-DPB1)
   05323 Rheumatoid arthritis
    3115 (HLA-DPB1)
   05320 Autoimmune thyroid disease
    3115 (HLA-DPB1)
   05321 Inflammatory bowel disease
    3115 (HLA-DPB1)
   05330 Allograft rejection
    3115 (HLA-DPB1)
   05332 Graft-versus-host disease
    3115 (HLA-DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3115 (HLA-DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3115 (HLA-DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3115 (HLA-DPB1)
   05152 Tuberculosis
    3115 (HLA-DPB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3115 (HLA-DPB1)
   05164 Influenza A
    3115 (HLA-DPB1)
   05168 Herpes simplex virus 1 infection
    3115 (HLA-DPB1)
   05169 Epstein-Barr virus infection
    3115 (HLA-DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3115 (HLA-DPB1)
   05140 Leishmaniasis
    3115 (HLA-DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3115 (HLA-DPB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3115 (HLA-DPB1)
  Exosomal proteins of epithelial cells
   3115 (HLA-DPB1)
  Exosomal proteins of breast milk
   3115 (HLA-DPB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Marek_A ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 3115
NCBI-ProteinID: NP_002112
OMIM: 142858
HGNC: 4940
Ensembl: ENSG00000223865
Vega: OTTHUMG00000031076
Pharos: P04440(Tbio)
UniProt: P04440 I4EC15
Structure
PDB: 

Position
6p21.32
AA seq 258 aa
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggttctgcaggtttctgcggccccccggacagtggctctgacggcgttactgatg
gtgctgctcacatctgtggtccagggcagggccactccagagaattaccttttccaggga
cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagatacatctacaac
cgggaggagttcgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg
gggcggcctgctgcggagtactggaacagccagaaggacatcctggaggagaagcgggca
gtgccggacaggatgtgcagacacaactacgagctgggcgggcccatgaccctgcagcgc
cgagtccagcctagggtgaatgtttccccctccaagaaggggcccttgcagcaccacaac
ctgcttgtctgccacgtgacggatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagatgtctacacctgc
caagtggagcacaccagcctggatagtcctgtcaccgtggagtggaaggcacagtctgat
tctgcccggagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt
ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa

KEGG   Homo sapiens (human): 3117
Entry
3117              CDS       T01001                                 

Gene name
HLA-DQA1, CELIAC1, DQ-A1, DQA1, HLA-DQA
Definition
(RefSeq) major histocompatibility complex, class II, DQ alpha 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy
H00408  Type 1 diabetes mellitus
H01362  Dermatitis herpetiformis
H01492  Systemic sclerosis
H02123  Celiac disease
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3117 (HLA-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3117 (HLA-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3117 (HLA-DQA1)
   04612 Antigen processing and presentation
    3117 (HLA-DQA1)
   04658 Th1 and Th2 cell differentiation
    3117 (HLA-DQA1)
   04659 Th17 cell differentiation
    3117 (HLA-DQA1)
   04672 Intestinal immune network for IgA production
    3117 (HLA-DQA1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3117 (HLA-DQA1)
   05322 Systemic lupus erythematosus
    3117 (HLA-DQA1)
   05323 Rheumatoid arthritis
    3117 (HLA-DQA1)
   05320 Autoimmune thyroid disease
    3117 (HLA-DQA1)
   05321 Inflammatory bowel disease
    3117 (HLA-DQA1)
   05330 Allograft rejection
    3117 (HLA-DQA1)
   05332 Graft-versus-host disease
    3117 (HLA-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3117 (HLA-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3117 (HLA-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3117 (HLA-DQA1)
   05152 Tuberculosis
    3117 (HLA-DQA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3117 (HLA-DQA1)
   05164 Influenza A
    3117 (HLA-DQA1)
   05168 Herpes simplex virus 1 infection
    3117 (HLA-DQA1)
   05169 Epstein-Barr virus infection
    3117 (HLA-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3117 (HLA-DQA1)
   05140 Leishmaniasis
    3117 (HLA-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3117 (HLA-DQA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3117 (HLA-DQA1)
  Exosomal proteins of epithelial cells
   3117 (HLA-DQA1)
  Exosomal proteins of breast milk
   3117 (HLA-DQA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A Ig_2 I-set
Other DBs
NCBI-GeneID: 3117
NCBI-ProteinID: NP_002113
OMIM: 146880
HGNC: 4942
Ensembl: ENSG00000196735
Vega: OTTHUMG00000031106
Pharos: P01909(Tbio)
UniProt: P01909 A0A173ADG5 Q8MH44
Structure
PDB: 
6DIG 4MAY 3PL6 4GRL 1UVQ

Position
6p21.32
AA seq 255 aa
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV
DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag
ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt
gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt
aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc
tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga

KEGG   Homo sapiens (human): 3118
Entry
3118              CDS       T01001                                 

Gene name
HLA-DQA2, DC-alpha, DX-ALPHA, HLA-DCA, HLA-DXA, HLADQA2
Definition
(RefSeq) major histocompatibility complex, class II, DQ alpha 2
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3118 (HLA-DQA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3118 (HLA-DQA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3118 (HLA-DQA2)
   04612 Antigen processing and presentation
    3118 (HLA-DQA2)
   04658 Th1 and Th2 cell differentiation
    3118 (HLA-DQA2)
   04659 Th17 cell differentiation
    3118 (HLA-DQA2)
   04672 Intestinal immune network for IgA production
    3118 (HLA-DQA2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3118 (HLA-DQA2)
   05322 Systemic lupus erythematosus
    3118 (HLA-DQA2)
   05323 Rheumatoid arthritis
    3118 (HLA-DQA2)
   05320 Autoimmune thyroid disease
    3118 (HLA-DQA2)
   05321 Inflammatory bowel disease
    3118 (HLA-DQA2)
   05330 Allograft rejection
    3118 (HLA-DQA2)
   05332 Graft-versus-host disease
    3118 (HLA-DQA2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3118 (HLA-DQA2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3118 (HLA-DQA2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3118 (HLA-DQA2)
   05152 Tuberculosis
    3118 (HLA-DQA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3118 (HLA-DQA2)
   05164 Influenza A
    3118 (HLA-DQA2)
   05168 Herpes simplex virus 1 infection
    3118 (HLA-DQA2)
   05169 Epstein-Barr virus infection
    3118 (HLA-DQA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3118 (HLA-DQA2)
   05140 Leishmaniasis
    3118 (HLA-DQA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3118 (HLA-DQA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3118 (HLA-DQA2)
  Exosomal proteins of epithelial cells
   3118 (HLA-DQA2)
  Exosomal proteins of breast milk
   3118 (HLA-DQA2)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 WW
Other DBs
NCBI-GeneID: 3118
NCBI-ProteinID: NP_064440
OMIM: 613503
HGNC: 4943
Ensembl: ENSG00000237541
Vega: OTTHUMG00000031108
Pharos: P01906(Tbio)
UniProt: P01906 Q76NI6
Position
6p21.32
AA seq 255 aa
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccatgttgcctcctatggtgtgaacttctaccag
tctcacggtccctctggccagtacacccatgaatttgatggagacgaggagttctatgtg
gacctggagacgaaagagactgtctggcagttgcctatgtttagcaaatttataagtttt
gacccgcagagtgcactgagaaatatggctgtgggaaaacacaccttggaattcatgatg
agacagtccaactctaccgctgccaccaatgaggttcctgaggtcacagtgttttccaag
tttcctgtgacgctgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtcaacatcacctggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactttggtc
tgcgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggctcttatga

KEGG   Homo sapiens (human): 3119
Entry
3119              CDS       T01001                                 

Gene name
HLA-DQB1, CELIAC1, HLA-DQB, IDDM1
Definition
(RefSeq) major histocompatibility complex, class II, DQ beta 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy
H00295  Viral myocarditis
H00342  Tuberculosis
H00408  Type 1 diabetes mellitus
H01362  Dermatitis herpetiformis
H01490  Multiple sclerosis
H01492  Systemic sclerosis
H02123  Celiac disease
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3119 (HLA-DQB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3119 (HLA-DQB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3119 (HLA-DQB1)
   04612 Antigen processing and presentation
    3119 (HLA-DQB1)
   04658 Th1 and Th2 cell differentiation
    3119 (HLA-DQB1)
   04659 Th17 cell differentiation
    3119 (HLA-DQB1)
   04672 Intestinal immune network for IgA production
    3119 (HLA-DQB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3119 (HLA-DQB1)
   05322 Systemic lupus erythematosus
    3119 (HLA-DQB1)
   05323 Rheumatoid arthritis
    3119 (HLA-DQB1)
   05320 Autoimmune thyroid disease
    3119 (HLA-DQB1)
   05321 Inflammatory bowel disease
    3119 (HLA-DQB1)
   05330 Allograft rejection
    3119 (HLA-DQB1)
   05332 Graft-versus-host disease
    3119 (HLA-DQB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3119 (HLA-DQB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3119 (HLA-DQB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3119 (HLA-DQB1)
   05152 Tuberculosis
    3119 (HLA-DQB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3119 (HLA-DQB1)
   05164 Influenza A
    3119 (HLA-DQB1)
   05168 Herpes simplex virus 1 infection
    3119 (HLA-DQB1)
   05169 Epstein-Barr virus infection
    3119 (HLA-DQB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3119 (HLA-DQB1)
   05140 Leishmaniasis
    3119 (HLA-DQB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3119 (HLA-DQB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3119 (HLA-DQB1)
  Exosomal proteins of epithelial cells
   3119 (HLA-DQB1)
  Exosomal proteins of breast milk
   3119 (HLA-DQB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 3119
NCBI-ProteinID: NP_001230891
OMIM: 604305
HGNC: 4944
Ensembl: ENSG00000179344
Vega: OTTHUMG00000031124
Pharos: P01920(Tbio)
UniProt: P01920 Q5Y7D3
Structure
PDB: 

Position
6p21.32
AA seq 261 aa
MSWKKALRIPGGLRAATVTLMLSMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVS
RSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttggaaaaaggctttgcggatccccggaggccttcgggcagcaactgtgaccttg
atgctgtcgatgctgagcaccccagtggctgagggcagagactctcccgaggatttcgtg
taccagtttaagggcatgtgctacttcaccaacgggacagagcgcgtgcgtcttgtgagc
agaagcatctataaccgagaagagatcgtgcgcttcgacagcgacgtgggggagttccgg
gcggtgacgctgctggggctgcctgccgccgagtactggaacagccagaaggacatcctg
gagaggaaacgggcggcggtggacagggtgtgcagacacaactaccagttggagctccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccagcccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagctggcgttgtgtccaccccccttatt
aggaatggtgactggaccttccagatcctggtgatgctggaaatgactccccagcgtgga
gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggcttcgtgctg
gggctgatcttcctcgggctgggccttatcatccatcacaggagtcagaaagggctcctg
cactga

KEGG   Homo sapiens (human): 3122
Entry
3122              CDS       T01001                                 

Gene name
HLA-DRA, HLA-DRA1
Definition
(RefSeq) major histocompatibility complex, class II, DR alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3122 (HLA-DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3122 (HLA-DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3122 (HLA-DRA)
   04612 Antigen processing and presentation
    3122 (HLA-DRA)
   04658 Th1 and Th2 cell differentiation
    3122 (HLA-DRA)
   04659 Th17 cell differentiation
    3122 (HLA-DRA)
   04672 Intestinal immune network for IgA production
    3122 (HLA-DRA)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3122 (HLA-DRA)
   05322 Systemic lupus erythematosus
    3122 (HLA-DRA)
   05323 Rheumatoid arthritis
    3122 (HLA-DRA)
   05320 Autoimmune thyroid disease
    3122 (HLA-DRA)
   05321 Inflammatory bowel disease
    3122 (HLA-DRA)
   05330 Allograft rejection
    3122 (HLA-DRA)
   05332 Graft-versus-host disease
    3122 (HLA-DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3122 (HLA-DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3122 (HLA-DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3122 (HLA-DRA)
   05152 Tuberculosis
    3122 (HLA-DRA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3122 (HLA-DRA)
   05164 Influenza A
    3122 (HLA-DRA)
   05168 Herpes simplex virus 1 infection
    3122 (HLA-DRA)
   05169 Epstein-Barr virus infection
    3122 (HLA-DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3122 (HLA-DRA)
   05140 Leishmaniasis
    3122 (HLA-DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3122 (HLA-DRA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3122 (HLA-DRA)
  Exosomal proteins of epithelial cells
   3122 (HLA-DRA)
  Exosomal proteins of breast milk
   3122 (HLA-DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 3122
NCBI-ProteinID: NP_061984
OMIM: 142860
HGNC: 4947
Ensembl: ENSG00000204287
Vega: OTTHUMG00000031269
Pharos: P01903(Tbio)
UniProt: P01903 A0A0G2JMH6
Structure
PDB: 

Position
6p21.32
AA seq 254 aa
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GLRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat
cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgagagagcccaacgtcctcatctgtttcatagacaagttcaccccacca
gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacgtttacgactgcagggtggagcactggggcttggatgagcctcttctc
aagcactgggagtttgatgctccaagccctctcccagagactacagagaacgtggtgtgt
gccctgggcctgactgtgggtctggtgggcatcattattgggaccatcttcatcatcaag
ggattgcgcaaaagcaatgcagcagaacgcagggggcctctgtaa

KEGG   Homo sapiens (human): 3123
Entry
3123              CDS       T01001                                 

Gene name
HLA-DRB1, DRB1, HLA-DR1B, HLA-DRB, SS1
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy
H00342  Tuberculosis
H00408  Type 1 diabetes mellitus
H01468  Eosinophilic granulomatosis with polyangiitis
H01490  Multiple sclerosis
H01492  Systemic sclerosis
H01502  Sjogren syndrome
H01504  Vogt-Koyanagi-Harada syndrome
H01516  Adult onset Still disease
H01698  Giant cell arteritis
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3123 (HLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3123 (HLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3123 (HLA-DRB1)
   04612 Antigen processing and presentation
    3123 (HLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    3123 (HLA-DRB1)
   04659 Th17 cell differentiation
    3123 (HLA-DRB1)
   04672 Intestinal immune network for IgA production
    3123 (HLA-DRB1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3123 (HLA-DRB1)
   05322 Systemic lupus erythematosus
    3123 (HLA-DRB1)
   05323 Rheumatoid arthritis
    3123 (HLA-DRB1)
   05320 Autoimmune thyroid disease
    3123 (HLA-DRB1)
   05321 Inflammatory bowel disease
    3123 (HLA-DRB1)
   05330 Allograft rejection
    3123 (HLA-DRB1)
   05332 Graft-versus-host disease
    3123 (HLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3123 (HLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3123 (HLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3123 (HLA-DRB1)
   05152 Tuberculosis
    3123 (HLA-DRB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3123 (HLA-DRB1)
   05164 Influenza A
    3123 (HLA-DRB1)
   05168 Herpes simplex virus 1 infection
    3123 (HLA-DRB1)
   05169 Epstein-Barr virus infection
    3123 (HLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3123 (HLA-DRB1)
   05140 Leishmaniasis
    3123 (HLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3123 (HLA-DRB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3123 (HLA-DRB1)
  Exosomal proteins of epithelial cells
   3123 (HLA-DRB1)
  Exosomal proteins of breast milk
   3123 (HLA-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 I-set DUF202
Other DBs
NCBI-GeneID: 3123
NCBI-ProteinID: NP_001230894
OMIM: 142857
HGNC: 4948
Ensembl: ENSG00000196126
Vega: OTTHUMG00000031196
Pharos: P01912(Tbio)
UniProt: P01911 Q5Y7D1
Structure
PDB: 
6ATF 6ATI 6ATZ 1A6A

Position
6p21.32
AA seq 266 aa
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF
HNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV
QRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPRGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggagtactct
acgtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg
gagctggggcggcctgatgccgagtactggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaactactgcagacacaactacggggttgtggagagcttcacagtg
cagcggcgagtccatcctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cataacctcctggtctgttctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaagactggggtggtgtccacaggcctgatccacaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaagaggattcctgagctga

KEGG   Homo sapiens (human): 3125
Entry
3125              CDS       T01001                                 

Gene name
HLA-DRB3, DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 3
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3125 (HLA-DRB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3125 (HLA-DRB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3125 (HLA-DRB3)
   04612 Antigen processing and presentation
    3125 (HLA-DRB3)
   04658 Th1 and Th2 cell differentiation
    3125 (HLA-DRB3)
   04659 Th17 cell differentiation
    3125 (HLA-DRB3)
   04672 Intestinal immune network for IgA production
    3125 (HLA-DRB3)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3125 (HLA-DRB3)
   05322 Systemic lupus erythematosus
    3125 (HLA-DRB3)
   05323 Rheumatoid arthritis
    3125 (HLA-DRB3)
   05320 Autoimmune thyroid disease
    3125 (HLA-DRB3)
   05321 Inflammatory bowel disease
    3125 (HLA-DRB3)
   05330 Allograft rejection
    3125 (HLA-DRB3)
   05332 Graft-versus-host disease
    3125 (HLA-DRB3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3125 (HLA-DRB3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3125 (HLA-DRB3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3125 (HLA-DRB3)
   05152 Tuberculosis
    3125 (HLA-DRB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3125 (HLA-DRB3)
   05164 Influenza A
    3125 (HLA-DRB3)
   05168 Herpes simplex virus 1 infection
    3125 (HLA-DRB3)
   05169 Epstein-Barr virus infection
    3125 (HLA-DRB3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3125 (HLA-DRB3)
   05140 Leishmaniasis
    3125 (HLA-DRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3125 (HLA-DRB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3125 (HLA-DRB3)
  Exosomal proteins of epithelial cells
   3125 (HLA-DRB3)
  Exosomal proteins of breast milk
   3125 (HLA-DRB3)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 I-set DUF202 C2-set_2
Other DBs
NCBI-GeneID: 3125
NCBI-ProteinID: NP_072049
OMIM: 612735
HGNC: 4951
Pharos: P79483(Tchem)
UniProt: P79483 A0A4D6G1L1
Structure
PDB: 
3C5J 2Q6W 4H1L

Position
6p21.3
AA seq 266 aa
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF
HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctccagcttggcagcgttgacagtgacactgatg
gtgctgagctcccgactggctttcgctggggacacccgaccacgtttcttggagctgcgt
aagtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc
cataaccaggaggagttcctgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgtcgccgagtcctggaacagccagaaggacctcctggagcagaag
cggggccgggtggacaattactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacgggcctgatccagaatgga
gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac
acttgccaagtggagcacccaagcgtaacgagcgctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggattcctgagctga

KEGG   Homo sapiens (human): 3126
Entry
3126              CDS       T01001                                 

Gene name
HLA-DRB4, DR4, DRB4, HLA-DR4B, HLA-DRB4*
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 4
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H01468  Eosinophilic granulomatosis with polyangiitis
H01504  Vogt-Koyanagi-Harada syndrome
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3126 (HLA-DRB4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3126 (HLA-DRB4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3126 (HLA-DRB4)
   04612 Antigen processing and presentation
    3126 (HLA-DRB4)
   04658 Th1 and Th2 cell differentiation
    3126 (HLA-DRB4)
   04659 Th17 cell differentiation
    3126 (HLA-DRB4)
   04672 Intestinal immune network for IgA production
    3126 (HLA-DRB4)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3126 (HLA-DRB4)
   05322 Systemic lupus erythematosus
    3126 (HLA-DRB4)
   05323 Rheumatoid arthritis
    3126 (HLA-DRB4)
   05320 Autoimmune thyroid disease
    3126 (HLA-DRB4)
   05321 Inflammatory bowel disease
    3126 (HLA-DRB4)
   05330 Allograft rejection
    3126 (HLA-DRB4)
   05332 Graft-versus-host disease
    3126 (HLA-DRB4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3126 (HLA-DRB4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3126 (HLA-DRB4)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3126 (HLA-DRB4)
   05152 Tuberculosis
    3126 (HLA-DRB4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3126 (HLA-DRB4)
   05164 Influenza A
    3126 (HLA-DRB4)
   05168 Herpes simplex virus 1 infection
    3126 (HLA-DRB4)
   05169 Epstein-Barr virus infection
    3126 (HLA-DRB4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3126 (HLA-DRB4)
   05140 Leishmaniasis
    3126 (HLA-DRB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3126 (HLA-DRB4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3126 (HLA-DRB4)
  Exosomal proteins of epithelial cells
   3126 (HLA-DRB4)
  Exosomal proteins of breast milk
   3126 (HLA-DRB4)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Other DBs
NCBI-GeneID: 3126
NCBI-ProteinID: NP_068818
HGNC: 4952
Pharos: P13762(Tdark)
UniProt: P13762 X5D2U9
Position
6p21.3
AA seq 266 aa
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYI
YNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLL
FLGTGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggctcctgtatggcagcgctgacagtgacattgacg
gtgctgagctccccactggctttggctggggacacccaaccacgtttcttggagcaggct
aagtgtgagtgtcatttcctcaatgggacggagcgagtgtggaacctgatcagatacatc
tataaccaagaggagtacgcgcgctacaacagtgacctgggggagtaccaggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacctcctggagcggagg
cgggccgaggtggacacctactgcagatacaactacggggttgtggagagcttcacagtg
cagcggcgagtccaacctaaggtgactgtgtatccttcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac
acctgccaagtggagcatccaagcatgatgagccctctcacggtgcaatggagtgcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttgggacagggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcttgagctga

KEGG   Homo sapiens (human): 3127
Entry
3127              CDS       T01001                                 

Gene name
HLA-DRB5, HLA-DRB5*
Definition
(RefSeq) major histocompatibility complex, class II, DR beta 5
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H02424  Primary central nervous system lymphoma
Drug target
Apolizumab: D02967
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3127 (HLA-DRB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3127 (HLA-DRB5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3127 (HLA-DRB5)
   04612 Antigen processing and presentation
    3127 (HLA-DRB5)
   04658 Th1 and Th2 cell differentiation
    3127 (HLA-DRB5)
   04659 Th17 cell differentiation
    3127 (HLA-DRB5)
   04672 Intestinal immune network for IgA production
    3127 (HLA-DRB5)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    3127 (HLA-DRB5)
   05322 Systemic lupus erythematosus
    3127 (HLA-DRB5)
   05323 Rheumatoid arthritis
    3127 (HLA-DRB5)
   05320 Autoimmune thyroid disease
    3127 (HLA-DRB5)
   05321 Inflammatory bowel disease
    3127 (HLA-DRB5)
   05330 Allograft rejection
    3127 (HLA-DRB5)
   05332 Graft-versus-host disease
    3127 (HLA-DRB5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3127 (HLA-DRB5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3127 (HLA-DRB5)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3127 (HLA-DRB5)
   05152 Tuberculosis
    3127 (HLA-DRB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3127 (HLA-DRB5)
   05164 Influenza A
    3127 (HLA-DRB5)
   05168 Herpes simplex virus 1 infection
    3127 (HLA-DRB5)
   05169 Epstein-Barr virus infection
    3127 (HLA-DRB5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3127 (HLA-DRB5)
   05140 Leishmaniasis
    3127 (HLA-DRB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3127 (HLA-DRB5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3127 (HLA-DRB5)
  Exosomal proteins of epithelial cells
   3127 (HLA-DRB5)
  Exosomal proteins of breast milk
   3127 (HLA-DRB5)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 3127
NCBI-ProteinID: NP_002116
OMIM: 604776
HGNC: 4953
Ensembl: ENSG00000198502
Vega: OTTHUMG00000031027
Pharos: Q30154(Tbio)
UniProt: Q30154 A0A2Z4LKS3
Structure
PDB: 
1FV1 1ZGL 1HQR 1H15

Position
6p21.32
AA seq 266 aa
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDI
YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFKNQKGHSGLHPTGLVS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaagctccctggaggttcctacatggcaaagctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgcagcaggat
aagtatgagtgtcatttcttcaacgggacggagcgggtgcggttcctgcacagagacatc
tataaccaagaggaggacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgctgagtactggaacagccagaaggacttcctggaagacagg
cgcgccgcggtggacacctactgcagacacaactacggggttggtgagagcttcacagtg
cagcggcgagttgagcctaaggtgactgtgtatcctgcaaggacccagaccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaacagccaggaagagaaggctggggtggtgtccacaggcctgattcagaatgga
gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac
acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacag
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctattcatctacttcaagaatcagaaagggcactctggacttcac
ccaacaggactcgtgagctga

KEGG   Homo sapiens (human): 3133
Entry
3133              CDS       T01001                                 

Gene name
HLA-E, HLA-6.2, QA1
Definition
(RefSeq) major histocompatibility complex, class I, E
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3133 (HLA-E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3133 (HLA-E)
   04145 Phagosome
    3133 (HLA-E)
  09143 Cell growth and death
   04218 Cellular senescence
    3133 (HLA-E)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3133 (HLA-E)
   04612 Antigen processing and presentation
    3133 (HLA-E)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3133 (HLA-E)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3133 (HLA-E)
   05330 Allograft rejection
    3133 (HLA-E)
   05332 Graft-versus-host disease
    3133 (HLA-E)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3133 (HLA-E)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3133 (HLA-E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3133 (HLA-E)
   05170 Human immunodeficiency virus 1 infection
    3133 (HLA-E)
   05168 Herpes simplex virus 1 infection
    3133 (HLA-E)
   05163 Human cytomegalovirus infection
    3133 (HLA-E)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3133 (HLA-E)
   05169 Epstein-Barr virus infection
    3133 (HLA-E)
   05165 Human papillomavirus infection
    3133 (HLA-E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3133 (HLA-E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3133 (HLA-E)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3133 (HLA-E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3133 (HLA-E)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 MHC_I_C C2-set_2 ig
Other DBs
NCBI-GeneID: 3133
NCBI-ProteinID: NP_005507
OMIM: 143010
HGNC: 4962
Ensembl: ENSG00000204592
Vega: OTTHUMG00000031155
Pharos: P13747(Tbio)
UniProt: P13747 A0A4E9D3W4 O19682 A8K8M6
Structure
PDB: 

Position
6p22.1
AA seq 358 aa
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMH
GCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAY
LEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQ
PTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggtagatggaaccctccttttactcctctcggaggccctggcccttacccagacctgg
gcgggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggag
ccccgcttcatctctgtgggctacgtggacgacacccagttcgtgcgcttcgacaacgac
gccgcgagtccgaggatggtgccgcgggcgccgtggatggagcaggaggggtcagagtat
tgggaccgggagacacggagcgccagggacaccgcacagattttccgagtgaatctgcgg
acgctgcgcggctactacaatcagagcgaggccgggtctcacaccctgcagtggatgcat
ggctgcgagctggggcccgacgggcgcttcctccgcgggtatgaacagttcgcctacgac
ggcaaggattatctcaccctgaatgaggacctgcgctcctggaccgcggtggacacggcg
gctcagatctccgagcaaaagtcaaatgatgcctctgaggcggagcaccagagagcctac
ctggaagacacatgcgtggagtggctccacaaatacctggagaaggggaaggagacgctg
cttcacctggagcccccaaagacacacgtgactcaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcag
gatggggagggccatacccaggacacggagctcgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctacccgagcccgtcaccctgagatggaagccggcttcccag
cccaccatccccatcgtgggcatcattgctggcctggttctccttggatctgtggtctct
ggagctgtggttgctgctgtgatatggaggaagaagagctcaggtggaaaaggagggagc
tactctaaggctgagtggagcgacagtgcccaggggtctgagtctcacagcttgtaa

KEGG   Homo sapiens (human): 3134
Entry
3134              CDS       T01001                                 

Gene name
HLA-F, CDA12, HLA-5.4, HLA-CDA12, HLAF
Definition
(RefSeq) major histocompatibility complex, class I, F
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3134 (HLA-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3134 (HLA-F)
   04145 Phagosome
    3134 (HLA-F)
  09143 Cell growth and death
   04218 Cellular senescence
    3134 (HLA-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3134 (HLA-F)
   04612 Antigen processing and presentation
    3134 (HLA-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3134 (HLA-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3134 (HLA-F)
   05330 Allograft rejection
    3134 (HLA-F)
   05332 Graft-versus-host disease
    3134 (HLA-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3134 (HLA-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3134 (HLA-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3134 (HLA-F)
   05170 Human immunodeficiency virus 1 infection
    3134 (HLA-F)
   05168 Herpes simplex virus 1 infection
    3134 (HLA-F)
   05163 Human cytomegalovirus infection
    3134 (HLA-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3134 (HLA-F)
   05169 Epstein-Barr virus infection
    3134 (HLA-F)
   05165 Human papillomavirus infection
    3134 (HLA-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3134 (HLA-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3134 (HLA-F)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3134 (HLA-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3134 (HLA-F)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 DUF357
Other DBs
NCBI-GeneID: 3134
NCBI-ProteinID: NP_061823
OMIM: 143110
HGNC: 4963
Ensembl: ENSG00000204642
Vega: OTTHUMG00000031156
Pharos: P30511(Tbio)
UniProt: P30511 Q5JZ47
Structure
PDB: 
5IUE 5KNM

Position
6p22.1
AA seq 346 aa
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcgccccgaagcctcctcctgctgctctcaggggccctggccctgaccgatacttgg
gcgggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggccgcggggag
ccccgctacatcgccgtggagtacgtagacgacacgcaattcctgcggttcgacagcgac
gccgcgattccgaggatggagccgcgggagccgtgggtggagcaagaggggccgcagtat
tgggagtggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgagg
aacctgctccgccgctacaaccagagcgaggctgggtctcacaccctccagggaatgaat
ggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcgtacgac
ggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcggacaccgtg
gctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggacctac
ctggagggcgagtgcctggagttgctccgcagatacttggagaatgggaaggagacgcta
cagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacgctgacctggcagcgg
gatggggaggaacagacccaggacacagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggccgctgtggtggtgcctcctggagaggaacagagatacacatgc
catgtgcagcacgaggggctgccccagcccctcatcctgagatgggagcagtctccccag
cccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagctgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaagaagagctcagatagaaacagagggagc
tactctcaggctgcagtgtga

KEGG   Homo sapiens (human): 3135
Entry
3135              CDS       T01001                                 

Gene name
HLA-G, MHC-G
Definition
(RefSeq) major histocompatibility complex, class I, G
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3135 (HLA-G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3135 (HLA-G)
   04145 Phagosome
    3135 (HLA-G)
  09143 Cell growth and death
   04218 Cellular senescence
    3135 (HLA-G)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3135 (HLA-G)
   04612 Antigen processing and presentation
    3135 (HLA-G)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3135 (HLA-G)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3135 (HLA-G)
   05330 Allograft rejection
    3135 (HLA-G)
   05332 Graft-versus-host disease
    3135 (HLA-G)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3135 (HLA-G)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3135 (HLA-G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3135 (HLA-G)
   05170 Human immunodeficiency virus 1 infection
    3135 (HLA-G)
   05168 Herpes simplex virus 1 infection
    3135 (HLA-G)
   05163 Human cytomegalovirus infection
    3135 (HLA-G)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3135 (HLA-G)
   05169 Epstein-Barr virus infection
    3135 (HLA-G)
   05165 Human papillomavirus infection
    3135 (HLA-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3135 (HLA-G)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3135 (HLA-G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3135 (HLA-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3135 (HLA-G)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig SNO
Other DBs
NCBI-GeneID: 3135
NCBI-ProteinID: NP_002118
OMIM: 142871
HGNC: 4964
Ensembl: ENSG00000204632
Vega: OTTHUMG00000031157
Pharos: P17693(Tbio)
UniProt: P17693 Q6DU14
Structure
PDB: 

Position
6p22.1
AA seq 338 aa
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgcggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaatg
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgtggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggagaaagaagagctcagattga

DBGET integrated database retrieval system