KEGG   Homo sapiens (human): 3118Help
Entry
3118              CDS       T01001                                 

Gene name
HLA-DQA2, DC-alpha, DX-ALPHA, HLA-DCA, HLA-DXA, HLADQA2
Definition
(RefSeq) major histocompatibility complex, class II, DQ alpha 2
  KO
K06752  major histocompatibility complex, class II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3118 (HLA-DQA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3118 (HLA-DQA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3118 (HLA-DQA2)
   04612 Antigen processing and presentation
    3118 (HLA-DQA2)
   04658 Th1 and Th2 cell differentiation
    3118 (HLA-DQA2)
   04659 Th17 cell differentiation
    3118 (HLA-DQA2)
   04672 Intestinal immune network for IgA production
    3118 (HLA-DQA2)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    3118 (HLA-DQA2)
   05322 Systemic lupus erythematosus
    3118 (HLA-DQA2)
   05323 Rheumatoid arthritis
    3118 (HLA-DQA2)
   05320 Autoimmune thyroid disease
    3118 (HLA-DQA2)
   05321 Inflammatory bowel disease (IBD)
    3118 (HLA-DQA2)
   05330 Allograft rejection
    3118 (HLA-DQA2)
   05332 Graft-versus-host disease
    3118 (HLA-DQA2)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    3118 (HLA-DQA2)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3118 (HLA-DQA2)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    3118 (HLA-DQA2)
   05152 Tuberculosis
    3118 (HLA-DQA2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3118 (HLA-DQA2)
   05164 Influenza A
    3118 (HLA-DQA2)
   05168 Herpes simplex infection
    3118 (HLA-DQA2)
   05169 Epstein-Barr virus infection
    3118 (HLA-DQA2)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    3118 (HLA-DQA2)
   05140 Leishmaniasis
    3118 (HLA-DQA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3118 (HLA-DQA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3118 (HLA-DQA2)
  Exosomal proteins of epithelial cells
   3118 (HLA-DQA2)
  Exosomal proteins of breast milk
   3118 (HLA-DQA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 WW
Motif
Other DBs
NCBI-GeneID: 3118
NCBI-ProteinID: NP_064440
OMIM: 613503
HGNC: 4943
Ensembl: ENSG00000237541
Vega: OTTHUMG00000031108
Pharos: P01906(Tbio)
UniProt: P01906 Q76NI6
Position
6p21.32
AA seq 255 aa AA seqDB search
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccatgttgcctcctatggtgtgaacttctaccag
tctcacggtccctctggccagtacacccatgaatttgatggagacgaggagttctatgtg
gacctggagacgaaagagactgtctggcagttgcctatgtttagcaaatttataagtttt
gacccgcagagtgcactgagaaatatggctgtgggaaaacacaccttggaattcatgatg
agacagtccaactctaccgctgccaccaatgaggttcctgaggtcacagtgttttccaag
tttcctgtgacgctgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtcaacatcacctggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactttggtc
tgcgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggctcttatga

DBGET integrated database retrieval system