KEGG   Homo sapiens (human): 3134Help
Entry
3134              CDS       T01001                                 

Gene name
HLA-F, CDA12, HLA-5.4, HLA-CDA12, HLAF
Definition
(RefSeq) major histocompatibility complex, class I, F
  KO
K06751  major histocompatibility complex, class I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
 » show all
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3134 (HLA-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3134 (HLA-F)
   04145 Phagosome
    3134 (HLA-F)
  09143 Cell growth and death
   04218 Cellular senescence
    3134 (HLA-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3134 (HLA-F)
   04612 Antigen processing and presentation
    3134 (HLA-F)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    3134 (HLA-F)
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    3134 (HLA-F)
   05330 Allograft rejection
    3134 (HLA-F)
   05332 Graft-versus-host disease
    3134 (HLA-F)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    3134 (HLA-F)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3134 (HLA-F)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3134 (HLA-F)
   05170 Human immunodeficiency virus 1 infection
    3134 (HLA-F)
   05168 Herpes simplex virus 1 infection
    3134 (HLA-F)
   05163 Human cytomegalovirus infection
    3134 (HLA-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3134 (HLA-F)
   05169 Epstein-Barr virus infection
    3134 (HLA-F)
   05165 Human papillomavirus infection
    3134 (HLA-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3134 (HLA-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3134 (HLA-F)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3134 (HLA-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3134 (HLA-F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 Ig_2 DUF357 MHC_I_C
Motif
Other DBs
NCBI-GeneID: 3134
NCBI-ProteinID: NP_061823
OMIM: 143110
HGNC: 4963
Ensembl: ENSG00000204642
Vega: OTTHUMG00000031156
Pharos: P30511(Tbio)
UniProt: P30511 Q5JZ47
Structure
PDB: 

Position
6p22.1
AA seq 346 aa AA seqDB search
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgaagcctcctcctgctgctctcaggggccctggccctgaccgatacttgg
gcgggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggccgcggggag
ccccgctacatcgccgtggagtacgtagacgacacgcaattcctgcggttcgacagcgac
gccgcgattccgaggatggagccgcgggagccgtgggtggagcaagaggggccgcagtat
tgggagtggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgagg
aacctgctccgccgctacaaccagagcgaggctgggtctcacaccctccagggaatgaat
ggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcgtacgac
ggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcggacaccgtg
gctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggacctac
ctggagggcgagtgcctggagttgctccgcagatacttggagaatgggaaggagacgcta
cagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacgctgacctggcagcgg
gatggggaggaacagacccaggacacagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggccgctgtggtggtgcctcctggagaggaacagagatacacatgc
catgtgcagcacgaggggctgccccagcccctcatcctgagatgggagcagtctccccag
cccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagctgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaagaagagctcagatagaaacagagggagc
tactctcaggctgcagtgtga

DBGET integrated database retrieval system