KEGG   Homo sapiens (human): 323
Entry
323               CDS       T01001                                 
Symbol
APBB2, FE65L, FE65L1
Name
(RefSeq) amyloid beta precursor protein binding family B member 2
  KO
K04530  amyloid beta A4 precursor protein-binding family B member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    323 (APBB2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  Other PTB domain-containing proteins
   323 (APBB2)
SSDB
Motif
Pfam: PID WW PTB
Other DBs
NCBI-GeneID: 323
NCBI-ProteinID: NP_001159522
OMIM: 602710
HGNC: 582
Ensembl: ENSG00000163697
Pharos: Q92870(Tbio)
UniProt: Q92870 B4E2F2 B4DJ88
Position
4:complement(40810027..41214542)
AA seq 758 aa
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKN
STPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
NLSPTAVINITSEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRG
NHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
DIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGG
KINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA
VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLS
LVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATS
LHEICSKIMAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPV
DKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFM
GVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVR
PPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcagaagtacttccagctgactcaggtgttgacaccttggcagtgtttatggccagc
agcggaactacagacgtcacaaatcggaacagcccagccacaccaccaaacacccttaac
ctccgatcctcccacaatgaactgttgaacgctgaaataaaacacacagaaaccaagaac
agcacacctcccaaatgcaggaaaaaatatgcactaactaacatccaggcggccatgggc
ctctcggatccagctgcacagcccctgctgggaaatggctctgccaacatcaagctggtg
aaaaatggggagaaccagctccgtaaggctgcagagcaagggcagcaggaccccaacaaa
aacctgagccccactgcagtcatcaacataacttctgagaagttagagggtaaagagccc
cacccacaggattcctcgagctgtgagattttaccctcccagcccaggagaactaagagc
ttcctaaattactatgcagatctggaaacctcagccagagaactagagcagaaccgaggc
aatcaccatgggactgcggaagagaaatcccagccagtccagggccaggcctccaccatc
attgggaatggcgatttgctgctgcagaaaccaaacagaccccagtccagccctgaagac
ggccaagtagccacagtgtcatccagcccagaaaccaagaaggatcatccgaaaacaggg
gccaaaaccgactgtgcactgcaccggatccagaacctggcaccgagcgatgaggagtcc
agctggacaacgttgtcccaagacagtgcctcacccagctccccggatgaaacagatata
tggagtgatcactcatttcagactgatccagatttgccgcctggctggaaaagagtcagt
gacattgccgggacctattattggcacatcccaacaggaacgactcagtgggaacggccc
gtctccatcccagcagatctccagggttctaggaaagggtcacttagttctgtaacgcca
tctcccaccccagagaacgagaaacagccatggagtgattttgctgttctgaatggggga
aagattaatagtgacatttggaaggatttgcatgcagccactgttaacccggaccccagt
ttaaaagagtttgaaggagcaaccctacgctatgcatctttgaaactcagaaatgcccca
caccctgatgatgatgattcttgtagtatcaacagtgacccagaagccaagtgttttgct
gtgcgttctctgggatgggtagagatggcagaagaggacctcgcccccggtaaaagtagt
gttgcggtcaacaactgcatcaggcaactttcctactgcaaaaatgacatccgagacaca
gtcgggatttggggagaggggaaagacatgtacctgatcctggagaatgacatgctcagc
ctggtggaccccatggaccgcagcgtgctgcactcgcagcccatcgtcagcatccgcgtg
tggggcgtgggccgcgacaatggccgggattttgcttatgtagcaagagataaagataca
agaattttgaaatgtcatgtatttcgatgtgacacaccagcaaaagccattgccacaagt
ctccacgagatctgctccaagattatggctgaacggaagaatgccaaagcgctggcctgc
agctccttacaggaaagggccaatgtgaacctcgatgtccctttgcaagtagattttcca
acaccaaagactgagctggtccagaagttccacgtgcagtacttgggcatgttacctgta
gacaaaccagtcggaatggatattttgaacagtgccatagaaaatcttatgacctcatcc
aacaaggaggactggctgtcagtgaacatgaacgtggctgatgccactgtgactgtcatc
agtgaaaagaatgaagaggaagtcttagtggaatgtcgtgtgcgattcctgtccttcatg
ggtgttgggaaggacgtccacacatttgccttcatcatggacacggggaaccagcgcttt
gagtgccacgttttctggtgcgagcctaatgctggtaacgtgtctgaggcggtgcaggcc
gcctgcatgttacgatatcagaagtgcttggtagccaggccgccttctcagaaagttcga
ccacctccaccgccagcagattcagtaaccagaagagtcacaaccaatgtaaaacgaggg
gtcttatccctcattgacactttgaaacagaaacgccctgtcaccgaaatgccatag

DBGET integrated database retrieval system