KEGG   Homo sapiens (human): 3242
Entry
3242              CDS       T01001                                 
Symbol
HPD, 4-HPPD, 4HPPD, GLOD3, HPPDASE, PPD
Name
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00044  Tyrosine degradation, tyrosine => homogentisate
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00708  Tyrosine degradation
N10020  HPD inhibitior to downstream of deficinent FAH
Disease
H00165  Tyrosinemia
Drug target
Nitisinone: D05177<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    3242 (HPD)
   00360 Phenylalanine metabolism
    3242 (HPD)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    3242 (HPD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3242 (HPD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     3242 (HPD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3242 (HPD)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_5 RNase_Zc3h12a
Other DBs
NCBI-GeneID: 3242
NCBI-ProteinID: NP_002141
OMIM: 609695
HGNC: 5147
Ensembl: ENSG00000158104
Pharos: P32754(Tclin)
UniProt: P32754
Structure
Position
12:complement(121839527..121888611)
AA seq 393 aa
MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQATSFYCSKMGFEPLAYRGLETGSREVVSH
VIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEM
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLR
EKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgacgacttacagtgacaaaggggcaaagcctgagagaggccgattcctccacttccac
tctgtgaccttctgggttggcaacgccaagcaggccacgtcattctactgcagcaagatg
ggctttgaacctctagcctacaggggcctggagaccggttcccgggaggtggtcagccat
gtaatcaaacaagggaagattgtgtttgtcctctcctcagcgctcaacccctggaacaaa
gagatgggcgatcacctggtgaaacacggtgacggagtgaaggacattgcgttcgaggtg
gaagattgtgactacatcgtgcagaaagcacgggaacggggcgccaaaatcatgcgggag
ccctgggtagagcaagacaagtttgggaaggtgaagtttgctgtgctgcagacgtatggg
gacaccacacacaccctggtggagaagatgaactacatcggccaattcttgcctggatat
gaggccccagcgttcatggaccccctacttcctaaactgcccaaatgcagtctggagatg
atcgaccacattgtgggaaaccagcctgatcaggagatggtgtccgcctccgaatggtac
ctgaaaaacctgcagttccaccgcttctggtccgtggatgacacgcaggtgcacacggaa
tatagctctctgcgatccattgtggtggccaactatgaagagtccatcaagatgcccatc
aatgagccagcgcctggcaagaagaagtcccagatccaggaatatgtggactataacggg
ggcgctggggtccagcacatcgctctcaagaccgaagacatcatcacagcgattcgccac
ttgagagagagaggcctggagttcttatctgttccctccacgtactacaaacaactgcgg
gagaagctgaagacggccaagatcaaggtgaaggagaacattgatgccctggaggagctg
aaaatcctggtggactacgacgagaaaggctacctcctgcagatcttcaccaaaccggtg
caggaccggcccacgctcttcctggaagtcatccagcgccacaaccaccagggttttgga
gccggcaacttcaactcactgttcaaggctttcgaggaggagcagaacctgcggggtaac
ctcaccaacatggagaccaatggggtggtgcccggcatgtaa

DBGET integrated database retrieval system