KEGG   Homo sapiens (human): 3249Help
Entry
3249              CDS       T01001                                 

Gene name
HPN, TMPRSS1
Definition
(RefSeq) hepsin
  KO
K08665  hepsin [EC:3.4.21.106]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    3249 (HPN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    3249 (HPN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.106  hepsin
     3249 (HPN)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3249 (HPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Hepsin-SRCR SRCR_2 DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 3249
NCBI-ProteinID: NP_002142
OMIM: 142440
HGNC: 5155
Ensembl: ENSG00000105707
Vega: OTTHUMG00000182474
Pharos: P05981(Tchem)
UniProt: P05981 A0A140VJK9
Structure
PDB: 

Position
19q13.11
AA seq 417 aa AA seqDB search
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaaggagggtggccggactgtgccatgctgctccagacccaaggtggcagct
ctcactgcggggaccctgctacttctgacagccatcggggcggcatcctgggccattgtg
gctgttctcctcaggagtgaccaggagccgctgtacccagtgcaggtcagctctgcggac
gctcggctcatggtctttgacaagacggaagggacgtggcggctgctgtgctcctcgcgc
tccaacgccagggtagccggactcagctgcgaggagatgggcttcctcagggcactgacc
cactccgagctggacgtgcgaacggcgggcgccaatggcacgtcgggcttcttctgtgtg
gacgaggggaggctgccccacacccagaggctgctggaggtcatctccgtgtgtgattgc
cccagaggccgtttcttggccgccatctgccaagactgtggccgcaggaagctgcccgtg
gaccgcatcgtgggaggccgggacaccagcttgggccggtggccgtggcaagtcagcctt
cgctatgatggagcacacctctgtgggggatccctgctctccggggactgggtgctgaca
gccgcccactgcttcccggagcggaaccgggtcctgtcccgatggcgagtgtttgccggt
gccgtggcccaggcctctccccacggtctgcagctgggggtgcaggctgtggtctaccac
gggggctatcttccctttcgggaccccaacagcgaggagaacagcaacgatattgccctg
gtccacctctccagtcccctgcccctcacagaatacatccagcctgtgtgcctcccagct
gccggccaggccctggtggatggcaagatctgtaccgtgacgggctggggcaacacgcag
tactatggccaacaggccggggtactccaggaggctcgagtccccataatcagcaatgat
gtctgcaatggcgctgacttctatggaaaccagatcaagcccaagatgttctgtgctggc
taccccgagggtggcattgatgcctgccagggcgacagcggtggtccctttgtgtgtgag
gacagcatctctcggacgccacgttggcggctgtgtggcattgtgagttggggcactggc
tgtgccctggcccagaagccaggcgtctacaccaaagtcagtgacttccgggagtggatc
ttccaggccataaagactcactccgaagccagcggcatggtgacccagctctga

DBGET integrated database retrieval system