KEGG   Homo sapiens (human): 3356Help
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H01450  Obsessive-compulsive disorder
H01611  Alcohol dependence
H01646  Major depressive disorder
H01649  Schizophrenia
Drug target
Adatanserin hydrochloride: D02767
Altanserin tartrate: D02836
Amesergide: D02893
Aripiprazole (DG00906): D01164 D10355 D10364 D10516
Asenapine: D02995
Atiprosin maleate: D03005
Blonanserin: D01176
Brexpiprazole: D10309
Cariprazine (DG01305): D09876 D09997
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Clozapine: D00283
Cyamemazine (DG00872): D07307 D07756
Dimetotiazine (DG00843): D01902 D07854
Eplivanserin: D10006
Esmirtazapine maleate: D04055
Fananserin: D02656
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Iloperidone: D02666
Ketanserin (DG00265): D02363 D08099
Loxapine (DG00897): D00794 D02340 D08148
Lubazodone hydrochloride: D04788
Lurasidone: D04820
Mesoridazine (DG00883): D00795 D02671
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Naftidrofuryl (DG00290): D05107 D08244
Nefazodone (DG00953): D00819 D08257
Nelotanserin: D09645
Ocaperidone: D02675
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Paliperidone (DG00907): D05339 D05340
Pelanserin hydrochloride: D05395
Periciazine: D01485
Perospirone hydrochloride hydrate: D02372
Pimavanserin: D08969
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Pruvanserin (DG01278): D06632 D06633
Quetiapine (DG00899): D00458 D08456
Risperidone: D00426
Ritanserin: D05738
Sarpogrelate (DG01333): D01624 D08508
Sergolexole maleate: D05829
Sertindole: D00561
Setoperone: D02686
Temanogrel (DG01334): D09976 D09977
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Xylamidine tosylate: D06343
Zicronapine (DG01539): D10329 D10495
Ziprasidone (DG00892): D01939 D02100 D08687
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3356 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3356 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3356 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3356 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3356 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3356 (HTR2A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3356 (HTR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 3356
NCBI-ProteinID: NP_000612
OMIM: 182135
HGNC: 5293
Ensembl: ENSG00000102468
Vega: OTTHUMG00000016881
Pharos: P28223(Tclin)
UniProt: P28223
Position
13q14.2
AA seq 471 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

DBGET integrated database retrieval system