KEGG   Homo sapiens (human): 3356Help
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H01450  Obsessive-compulsive disorder (OCD)
H01611  Alcohol dependence
H01646  Major depressive disorder (MDD)
H01649  Schizophrenia
Drug target
Adatanserin hydrochloride: D02767
Altanserin tartrate: D02836
Amesergide: D02893
Aripiprazole (DG00906): D01164 D10355 D10364 D10516
Asenapine: D02995
Atiprosin maleate: D03005
Blonanserin: D01176
Brexpiprazole: D10309
Cariprazine (DG01305): D09876 D09997
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Clozapine: D00283
Cyamemazine (DG00872): D07307 D07756
Dimetotiazine (DG00843): D01902 D07854
Eplivanserin: D10006
Fananserin: D02656
Fenfluramine (DG00103): D04148 D07945
Flibanserin: D02577
Glemanserin: D04320
Iloperidone: D02666
Ketanserin (DG00265): D02363 D08099
Loxapine (DG00897): D00794 D02340 D08148
Lubazodone hydrochloride: D04788
Lurasidone: D04820
Mesoridazine (DG00883): D00795 D02671
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563 D11056
Naftidrofuryl (DG00290): D05107 D08244
Nefazodone (DG00953): D00819 D08257
Nelotanserin: D09645
Olanzapine (DG00898): D00454 D06623
Opipramol (DG00930): D01477 D08297
Paliperidone (DG00907): D05339 D05340
Pelanserin hydrochloride: D05395
Periciazine: D01485
Perospirone hydrochloride hydrate: D02372
Pimavanserin: D08969
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Pruvanserin (DG01278): D06632 D06633
Quetiapine (DG00899): D00458 D08456
Risperidone: D00426
Ritanserin: D05738
Sarpogrelate (DG01333): D01624 D08508
Sertindole: D00561
Setoperone: D02686
Temanogrel (DG01334): D09976 D09977
Trazodone (DG00952): D00820 D08626
Tropanserin hydrochloride: D06253
Xylamidine tosylate: D06343
Zicronapine (DG01539): D10329 D10495
Ziprasidone (DG00892): D01939 D02100 D08687
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3356 (HTR2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3356 (HTR2A)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    3356 (HTR2A)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3356 (HTR2A)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3356 (HTR2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    3356 (HTR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 3356
NCBI-ProteinID: NP_000612
OMIM: 182135
HGNC: 5293
Ensembl: ENSG00000102468
Vega: OTTHUMG00000016881
Pharos: P28223(Tclin)
UniProt: P28223
Position
13q14.2
AA seq 471 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

DBGET integrated database retrieval system