KEGG   Homo sapiens (human): 341405Help
Entry
341405            CDS       T01001                                 

Gene name
ANKRD33, C12orf7, PANKY
Definition
(RefSeq) ankyrin repeat domain 33
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 341405
NCBI-ProteinID: NP_872414
HGNC: 13788
Ensembl: ENSG00000167612
Vega: OTTHUMG00000169506
Pharos: Q7Z3H0(Tdark)
UniProt: Q7Z3H0 Q0VAA8 Q5K617
Position
12q13.13
AA seq 452 aa AA seqDB search
MKVQPSVTCVASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLL
VPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQLQAILDGGVS
PEEATQVDSNGRTGLMVACYHGFQSVVALLSHCPFLDVNQQDKGGDTALMLAAQAGHVPL
VSLLLNYYVGLDLERRDQRGLTALMKAAMRNRCADLTAVDPVRGKTALEWAVLTDSFDTV
WRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQ
EGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLGTAPPPPLVPQSPP
GSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSP
SGHQSLALPLWRYQELRIEKRKQEEEARMAQK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccagccatctgttacctgcgttgcttcctggggagggatagtccacctggag
gcattcggagacccagtgattgtgctccgcggagcctgggctgtgccccgcgttgactgc
ctcatagataccctacgaaccccaaatgccagctgcatgagaaaagggactcaccttctg
gttccctgcctggaagaggaagagctggcattgcacaggagacggctggacatgtctgag
gcactgccctgcccgggcaaggagacccccaccccaggctgcaggctgggggccctgtat
tgggcctgtgtccacaatgatcccacccagctccaagccatactggatggtggggtctcc
ccagaggaggccacccaggtggacagcaatgggaggacaggcctcatggtcgcatgctac
cacggcttccagagtgttgtggccctgctcagccactgtcctttccttgatgtgaaccag
caggacaaaggaggggacacggccctcatgttggctgcccaagcaggccacgtgcctcta
gtgagtctcctgctcaactactatgtgggcctggacctggaacgccgggaccagcggggg
ctcacggcgttaatgaaggctgccatgcggaaccgctgtgctgacctgacagcagtggac
cctgttcggggcaagacggccctggaatgggcagtgctgaccgacagcttcgacaccgtg
tggaggattcggcagctgctgaggcggccccaagtggagcagcttagccagcactacaag
cccgagtggccggccttgtccgggctcgtggcccaggcccaggcccaggcccaggttgcc
ccttcactcctagaacggctgcaggctaccttgagcctcccctttgccccgtctcctcag
gaggggggtgttctggaccaccttgtgactgccacaaccagcctggccagtcccttcgtc
accactgcctgccacactctgtgccctgaccatccaccttcgctgggcacccgaagcaag
tccgtgccagagctgttaggtactgccccgccccctcccctggttccccagtccccgcca
gggagtccccagaggtccccgtgggtcttcgtcccctaccagagccctcagggcatattg
agcaagtgccttcagtggctacaacccagggatagcaccagccccaggccccaagtcccc
aagatcctcctctccaaggcatcctcatcctcccaccagtgccagccgaagcccagtcct
tcaggacaccaaagtctggcccttcctctctggcgataccaggagctcaggatagagaag
aggaaacaggaggaggaggccagaatggcacagaagtag

DBGET integrated database retrieval system