KEGG   Homo sapiens (human): 341676Help
Entry
341676            CDS       T01001                                 

Gene name
NEK5
Definition
(RefSeq) NIMA related kinase 5
  KO
K08857  NIMA (never in mitosis gene a)-related kinase 1/4/5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    341676 (NEK5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    341676 (NEK5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    341676 (NEK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     341676 (NEK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NEK family
   341676 (NEK5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    341676 (NEK5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    341676 (NEK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal PBC
Motif
Other DBs
NCBI-GeneID: 341676
NCBI-ProteinID: NP_954983
OMIM: 616731
HGNC: 7748
Ensembl: ENSG00000197168
Vega: OTTHUMG00000016957
Pharos: Q6P3R8(Tdark)
UniProt: Q6P3R8
Position
13q14.3
AA seq 708 aa AA seqDB search
MDKYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKH
PNIVAFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIH
DRKILHRDIKAQNIFLSKNGMVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKP
YNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVLKICQAHFAPISPGFSRELHSLISQLF
QVSPRDRPSINSILKRPFLENLIPKYLTPEVIQEEFSHMLICRAGAPASRHAGKVVQKCK
IQKVRFQGKCPPRSRISVPIKRNAILHRNEWRPPAGAQKARSIKMIERPKIAAVCGHYDY
YYAQLDMLRRRAHKPSYHPIPQENTGVEDYGQETRHGPSPSQWPAEYLQRKFEAQQYKLK
VEKQLGLRPSSAEPNYNQRQELRSNGEEPRFQELPFRKNEMKEQEYWKQLEEIRQQYHND
MKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQMEFRSCCPGWSAMARS
WLTATSASQDIEKDLKQMRLQNTKESKNPEQKYKAKKGVKFEINLDKCISDENILQEEEA
MDIPNETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGG
APQTLLQMMAVADITSTCPTGPDSESVLSVSRQEGKTKDPYSPVLILM
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggataagtacgatgtgattaaggccatcgggcaaggtgccttcgggaaagcatactta
gctaaagggaaatcagatagcaagcactgtgtcataaaagagatcaattttgaaaagatg
cccatacaagaaaaagaagcttcaaagaaagaagtgattcttctggaaaagatgaaacat
cccaacattgtagccttcttcaattcatttcaagagaatggcaggctgtttattgtaatg
gaatattgtgatggaggggatctcatgaaaaggatcaatagacaacggggtgtgttattt
agtgaagatcagatcctcggttggtttgtacagatttctctaggactaaaacatattcat
gacaggaagatattacacagggacataaaagctcagaacatttttcttagcaagaacgga
atggtggcaaagcttggggactttggtatagcaagagtcctgaataattccatggaactt
gctcgaacttgtattggaacaccttactacctgtccccagagatctgtcagaataaaccc
tacaacaataaaacggatatttggtctcttggctgtgtcttatatgagctctgcacactt
aaacatccttttgagggtaacaacttacagcagctggttctgaagatttgtcaagcacat
tttgccccaatatctccggggttttctcgtgagctccattccttgatatctcagctcttt
caagtatctcctcgagaccgaccatccataaattccattttgaaaaggccctttttagag
aatcttattcccaaatatttgactcctgaggtcattcaggaagaattcagtcacatgctt
atatgcagagcaggagcgccagcttctcgacatgctgggaaggtggtccagaagtgtaaa
atacaaaaagtgagattccagggaaagtgcccaccaagatcaaggatatctgtgccaatt
aaaaggaatgctatattgcatagaaatgaatggagaccaccagctggagcccagaaggcc
agatctataaaaatgatagaaagacccaaaattgctgctgtctgtggacattatgattat
tattatgctcaacttgatatgctgaggaggagagcccacaaaccaagttatcaccctatt
cctcaagaaaatactggagttgaggattacggtcaggaaacgaggcatggtccatcccca
agtcaatggcctgctgagtaccttcagagaaaatttgaagctcaacaatataagttgaaa
gtggagaagcaattgggtcttcgtccatcttctgccgagccaaattacaaccagagacaa
gagctaagaagtaatggagaagagcctagattccaggagctgccatttaggaaaaacgaa
atgaaggaacaggaatattggaagcagttagaggaaatacgccaacagtaccacaatgac
atgaaagaaattagaaagaagatggggagagaaccagaggagaactcaaaaataagtcat
aaaacctatttggtgaagaagagtaacctgcctgtccatcaagatgcatctgagggagaa
gcacctgtgcagatggaatttcgctcttgttgcccaggctggagtgcaatggcacgatct
tggctcaccgcaacctccgcctcccaggacattgaaaaagacttgaaacaaatgaggctt
cagaacacaaaggaaagtaaaaatccagaacagaaatataaagctaagaagggggtaaaa
tttgaaattaatttagacaaatgtatttctgatgaaaacatcctccaagaggaagaggca
atggatataccaaatgaaactttgacctttgaggatggcatgaagtttaaggaatatgaa
tgtgtaaaggagcatggagattatacagacaaagcatttgaaaaacttcactgcccagaa
gcagggttttccacgcagactgtagctgctgtgggaaacaggaggcagtgggatggagga
gcgcctcagactctgctgcagatgatggcagtggccgacatcacctccacctgccccacg
gggcctgacagtgagtctgtgcttagcgtcagtcgtcaggaagggaagaccaaggacccg
tacagcccagtgctcatcctgatgtga

DBGET integrated database retrieval system