KEGG   Homo sapiens (human): 3460Help
Entry
3460              CDS       T01001                                 

Gene name
IFNGR2, AF-1, IFGR2, IFNGT1, IMD28
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05132  Salmonella infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
H00342  Tuberculosis
Drug target
Interferon gamma (DG00737): D00747 D03357 D08805
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3460 (IFNGR2)
   04066 HIF-1 signaling pathway
    3460 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3460 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3460 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3460 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    3460 (IFNGR2)
   04659 Th17 cell differentiation
    3460 (IFNGR2)
  09158 Development
   04380 Osteoclast differentiation
    3460 (IFNGR2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3460 (IFNGR2)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    3460 (IFNGR2)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    3460 (IFNGR2)
   05152 Tuberculosis
    3460 (IFNGR2)
  09172 Infectious diseases: Viral
   05162 Measles
    3460 (IFNGR2)
   05164 Influenza A
    3460 (IFNGR2)
   05168 Herpes simplex infection
    3460 (IFNGR2)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    3460 (IFNGR2)
   05140 Leishmaniasis
    3460 (IFNGR2)
   05142 Chagas disease (American trypanosomiasis)
    3460 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3460 (IFNGR2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IFN receptor family
   3460 (IFNGR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind fn3
Motif
Other DBs
NCBI-GeneID: 3460
NCBI-ProteinID: NP_005525
OMIM: 147569
HGNC: 5440
Ensembl: ENSG00000159128
Vega: OTTHUMG00000065188
Pharos: P38484(Tbio)
UniProt: P38484 A8K881
Structure
PDB: 

Position
21q22.11
AA seq 337 aa AA seqDB search
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRP
VVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELG
ALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYW
EKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMAD
ASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQ
PILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgacgctgctgtggtcgctgctgctgctgctcggagtcttcgccgccgccgcc
gcggccccgccagaccctctttcccagctgcccgctcctcagcacccgaagattcgcctg
tacaacgcagagcaggtcctgagttgggagccagtggccctgagcaatagcacgaggcct
gttgtctaccaagtgcagtttaaatacaccgacagtaaatggttcacggccgacatcatg
tccataggggtgaattgtacacagatcacagcaacagagtgtgacttcactgccgccagt
ccctcagcaggcttcccaatggatttcaatgtcactctacgccttcgagctgagctggga
gcactccattctgcctgggtgacaatgccttggtttcaacactatcggaatgtgactgtc
gggcctccagaaaacattgaggtgaccccaggagaaggctccctcatcatcaggttctcc
tctccctttgacatcgctgatacctccacggcctttttttgttattatgtccattactgg
gaaaaaggaggaatccaacaggtcaaaggccctttcagaagcaactccatttcattggat
aacttaaaaccctccagagtgtactgtttacaagtccaggcacaactgctttggaacaaa
agtaacatctttagagtcgggcatttaagcaacatatcttgctacgaaacaatggcagat
gcctccactgagcttcagcaagtcatcctgatctccgtgggaacattttcgttgctgtcg
gtgctggcaggagcctgtttcttcctggtcctgaaatatagaggcctgattaaatactgg
tttcacactccaccaagcatcccattacagatagaagagtatttaaaagacccaactcag
cccatcttagaggccttggacaaggacagctcaccaaaggatgacgtctgggactctgtg
tccattatctcgtttccggaaaaggagcaagaagatgttctccaaacgctttga

DBGET integrated database retrieval system