KEGG   Homo sapiens (human): 3480Help
Entry
3480              CDS       T01001                                 

Gene name
IGF1R, CD221, IGFIR, IGFR, JTK13
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04730  Long-term depression
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
Network
N00119  MLL-AF4 fusion to transcriptional activation
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00233  IGF2-IGF1R-RAS-ERK signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H00048  Hepatocellular carcinoma
H00050  Synovial sarcoma
H01274  Growth delay due to insulin-like growth factor I resistance
Drug target
Cixutumumab: D09328
Dalotuzumab: D09746
Figitumumab: D09345
Ganitumab: D09908
Istiratumab: D10943
Linsitinib: D09925
Mecasermin: D03297
Mecasermin rinfabate: D04870
Robatumumab: D10056
Teprotumumab: D09680
Toremifene (DG00735): D00967 D08620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3480 (IGF1R)
   04015 Rap1 signaling pathway
    3480 (IGF1R)
   04010 MAPK signaling pathway
    3480 (IGF1R)
   04066 HIF-1 signaling pathway
    3480 (IGF1R)
   04068 FoxO signaling pathway
    3480 (IGF1R)
   04151 PI3K-Akt signaling pathway
    3480 (IGF1R)
   04152 AMPK signaling pathway
    3480 (IGF1R)
   04150 mTOR signaling pathway
    3480 (IGF1R)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3480 (IGF1R)
   04140 Autophagy - animal
    3480 (IGF1R)
  Cell growth and death
   04114 Oocyte meiosis
    3480 (IGF1R)
  Cellular community - eukaryotes
   04510 Focal adhesion
    3480 (IGF1R)
   04520 Adherens junction
    3480 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    3480 (IGF1R)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    3480 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    3480 (IGF1R)
  Nervous system
   04730 Long-term depression
    3480 (IGF1R)
  Aging
   04211 Longevity regulating pathway - mammal
    3480 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    3480 (IGF1R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3480 (IGF1R)
   05202 Transcriptional misregulation in cancers
    3480 (IGF1R)
   05205 Proteoglycans in cancer
    3480 (IGF1R)
   05225 Hepatocellular carcinoma
    3480 (IGF1R)
   05214 Glioma
    3480 (IGF1R)
   05218 Melanoma
    3480 (IGF1R)
   05215 Prostate cancer
    3480 (IGF1R)
   05224 Breast cancer
    3480 (IGF1R)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3480 (IGF1R)
   01522 Endocrine resistance
    3480 (IGF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3480 (IGF1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   3480 (IGF1R)
CD molecules [BR:hsa04090]
 Proteins
  3480 (IGF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476
Motif
Other DBs
NCBI-GeneID: 3480
NCBI-ProteinID: NP_000866
OMIM: 147370
HGNC: 5465
Ensembl: ENSG00000140443
Vega: OTTHUMG00000149851
Pharos: P08069(Tclin)
UniProt: P08069
Structure
PDB: 

Position
15q26.3
AA seq 1367 aa AA seqDB search
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
attaccgagtacttgctgctgttccgagtggctggcctcgagagcctcggagacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcggtgtccaataactacattgtggggaataagcccccaaaggaatgtggggac
ctgtgtccagggaccatggaggagaagccgatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccaagcacgtgtggg
aagcgggcgtgcaccgagaacaatgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactatgccggtgtctgt
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagcgccgagagcagcgactccgaggggtttgtgatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgcccgaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagagctggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcctaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactgtgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattatgtgtttccgaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tcgaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccctttaagaatgtcacagagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactacatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatt
gaggaggtcacagagaaccccaagactgaggtgtgtggtggggagaaagggccttgctgc
gcctgccccaaaactgaagccgagaagcaggccgagaaggaggaggctgaataccgcaaa
gtctttgagaatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgca
gacacctacaacatcaccgacccggaagagctggagacagagtaccctttctttgagagc
agagtggataacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
atcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaacttc
gtctttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtac
ttcagcgctgctgatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagc
atgcgtgagaggattgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcac
catgtggtgcgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaa
ctgatgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctgagcaagatgattcagatggccggagagattgca
gacggcatggcatacctcaacgccaataagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtct
cctgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtc
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatg
ctgtttgaactgatgcgcatgtgctggcagtataaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagaggagatggagcctggcttccgggaggtctccttctac
tacagcgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggggtgctggtcctccgcgccagcttc
gacgagagacagccttacgcccacatgaacgggggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system